StarFunc result for job id O75191

User Input

>input (536 residues)
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75191	1.000	1.000	0.000	536	1.000	1.000	O75191.pdb.gz	XYLB_HUMAN Xylulose kinase OS=Homo sapiens OX=9606 GN=XYLB PE=1 SV=3
2	PDB:4bc2A	0.978	0.992	1.324E-101	528	0.985	1.000	4bc2A.pdb.gz	Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
3	AFDB:Q949W8	0.958	0.920	2.620E-69	558	0.463	0.444	Q949W8.pdb.gz	XK2_ARATH Xylulose kinase 2 OS=Arabidopsis thaliana OX=3702 GN=XK2 PE=1 SV=1
4	AFDB:Q9C0U6	0.906	0.876	4.963E-55	555	0.379	0.366	Q9C0U6.pdb.gz	XKS1_SCHPO Xylulose kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xks1 PE=3 SV=1
5	AFDB:P42826	0.919	0.823	8.274E-53	600	0.341	0.305	P42826.pdb.gz	XKS1_YEAST Xylulose kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=XKS1 PE=1 SV=2
6	AFDB:P09099	0.769	0.844	2.240E-30	484	0.187	0.207	P09099.pdb.gz	XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) OX=83333 GN=xylB PE=1 SV=1
7	PDB:2itmA	0.735	0.818	3.229E-30	476	0.177	0.200	2itmA.pdb.gz	Structural and kinetic studies of induced fit in xylulose kinase from Escherichia coli.
8	AFDB:P77432	0.719	0.727	2.694E-28	530	0.160	0.162	P77432.pdb.gz	LSRK_ECOLI Autoinducer-2 kinase OS=Escherichia coli (strain K12) OX=83333 GN=lsrK PE=1 SV=1
9	AFDB:Q2YIQ1	0.784	0.806	2.131E-27	520	0.157	0.162	Q2YIQ1.pdb.gz	ERYA_BRUA2 Erythritol kinase OS=Brucella abortus (strain 2308) OX=359391 GN=eryA PE=1 SV=2
10	AFDB:P11553	0.721	0.811	1.091E-26	472	0.147	0.167	P11553.pdb.gz	FUCK_ECOLI L-fuculokinase OS=Escherichia coli (strain K12) OX=83333 GN=fucK PE=1 SV=4
11	AFDB:O51257	0.675	0.716	2.468E-26	501	0.183	0.196	O51257.pdb.gz	GLPK_BORBU Glycerol kinase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=glpK PE=3 SV=1
12	AFDB:P37677	0.707	0.754	6.574E-26	498	0.160	0.173	P37677.pdb.gz	LYXK_ECOLI L-xylulose/3-keto-L-gulonate kinase OS=Escherichia coli (strain K12) OX=83333 GN=lyx PE=1 SV=1
13	PDB:5ya0A	0.656	0.723	1.860E-23	480	0.155	0.173	5ya0A.pdb.gz
14	PDB:1bu6Y	0.615	0.655	1.447E-21	499	0.155	0.166	1bu6Y.pdb.gz	Glycerol kinase from Escherichia coli and an Ala65-->Thr mutant: the crystal structures reveal conformational changes with implications for allosteric regulation.
15	PDB:5htvA	0.624	0.774	3.401E-20	424	0.136	0.172	5htvA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
16	PDB:2cgjA	0.609	0.670	4.391E-19	479	0.162	0.182	2cgjA.pdb.gz	Structure and Reaction Mechanism of L-Rhamnulose Kinase from Escherichia Coli.
17	PDB:5huxA	0.599	0.734	1.215E-17	429	0.140	0.175	5huxA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
18	PDB:3wquB	0.291	0.388	1.110E-5	371	0.106	0.154	3wquB.pdb.gz	Crystal structure of FtsA from Staphylococcus aureus
19	PDB:4a2bA	0.255	0.328	1.716E-5	386	0.093	0.130	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments
20	PDB:4ehtA	0.276	0.462	3.297E-5	268	0.069	0.138	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75191	0.0	1116	536	1.000	1.000	XYLB_HUMAN Xylulose kinase OS=Homo sapiens OX=9606 GN=XYLB PE=1 SV=3
2	Q949W8	1.27e-161	473	558	0.453	0.435	XK2_ARATH Xylulose kinase 2 OS=Arabidopsis thaliana OX=3702 GN=XK2 PE=1 SV=1
3	Q9C0U6	1.36e-104	326	555	0.381	0.368	XKS1_SCHPO Xylulose kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xks1 PE=3 SV=1
4	P42826	7.29e-94	300	600	0.334	0.298	XKS1_YEAST Xylulose kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=XKS1 PE=1 SV=2
5	P09099	7.30e-05	47.8	484	0.108	0.120	XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) OX=83333 GN=xylB PE=1 SV=1
6	P77432	0.003	42.7	530	0.136	0.138	LSRK_ECOLI Autoinducer-2 kinase OS=Escherichia coli (strain K12) OX=83333 GN=lsrK PE=1 SV=1
7	Q9M8L4	0.005	42.0	522	0.131	0.134	GLPK_ARATH Glycerol kinase OS=Arabidopsis thaliana OX=3702 GN=GLPK PE=1 SV=1
8	P37677	0.015	40.4	498	0.065	0.070	LYXK_ECOLI L-xylulose/3-keto-L-gulonate kinase OS=Escherichia coli (strain K12) OX=83333 GN=lyx PE=1 SV=1
9	P11553	0.20	36.6	472	0.043	0.049	FUCK_ECOLI L-fuculokinase OS=Escherichia coli (strain K12) OX=83333 GN=fucK PE=1 SV=4
10	O51257	0.42	35.8	501	0.200	0.214	GLPK_BORBU Glycerol kinase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=glpK PE=3 SV=1
11	Q9W095	0.42	35.8	576	0.164	0.153	Q9W095_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=2
12	Q961K9	0.45	35.8	576	0.164	0.153	Q961K9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=1
13	Q382T3	2.0	33.9	637	0.041	0.035	Q382T3_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4320 PE=3 SV=1
14	Q9NJP9	2.0	33.5	512	0.091	0.096	GLPK_TRYBB Glycerol kinase, glycosomal OS=Trypanosoma brucei brucei OX=5702 GN=GK PE=1 SV=1
15	Q8I5S7	2.4	33.5	583	0.026	0.024	Q8I5S7_PLAF7 Glycerol-3-phosphate 1-O-acyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1212500 PE=4 SV=1
16	Q9IAX2	2.5	33.1	279	0.045	0.086	IOD2_CHICK Type II iodothyronine deiodinase OS=Gallus gallus OX=9031 GN=DIO2 PE=1 SV=3
17	Q38BL2	5.2	32.3	761	0.058	0.041	Q38BL2_TRYB2 Phospholipid/glycerol acyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3450 PE=4 SV=1
18	Q9HTE6	6.5	32.0	1005	0.035	0.019	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
19	Q61137	7.4	32.0	1302	0.039	0.016	ASTN1_MOUSE Astrotactin-1 OS=Mus musculus OX=10090 GN=Astn1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02782 FGGY_C	9.7e-16	69.7	FGGY family of carbohydrate kinases, C-terminal domain
2	PF00370 FGGY_N	5e-12	57.5	FGGY family of carbohydrate kinases, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000207870

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352401	0.995	Ribulose-phosphate 3-epimerase
2	9606.ENSP00000476672	0.984	Ribulose-phosphate 3-epimerase-like protein 1
3	9606.ENSP00000321259	0.982	Transaldolase
4	9606.ENSP00000273173	0.930	Solute carrier family 22 member 14
5	9606.ENSP00000310241	0.917	Solute carrier family 22 member 13
6	9606.ENSP00000267814	0.849	Sorbitol dehydrogenase
7	9606.ENSP00000368727	0.847	Xanthine dehydrogenase/oxidase
8	9606.ENSP00000283646	0.837	Ribose 5-phosphate isomerase A
9	9606.ENSP00000391481	0.816	Transketolase
10	9606.ENSP00000311713	0.768	Serine/threonine-protein kinase OSR1
11	9606.ENSP00000285930	0.751	Aldose reductase
12	9606.ENSP00000229270	0.729	Triosephosphate isomerase 1
13	9606.ENSP00000473348	0.712	GDH/6PGL endoplasmic bifunctional protein
14	9606.ENSP00000221403	0.701	Dihydrodiol dehydrogenase
15	9606.ENSP00000252603	0.668	6-phosphogluconolactonase
16	9606.ENSP00000370966	0.660	Quinone oxidoreductase-like protein 1
17	9606.ENSP00000270776	0.653	6-phosphogluconate dehydrogenase, decarboxylating
18	9606.ENSP00000339495	0.647	Negative elongation factor B
19	9606.ENSP00000263702	0.633	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
20	9606.ENSP00000330918	0.633	Glycerol-3-phosphate phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004856	1.000	xylulokinase activity
GO:0005488	0.894	binding
GO:0005515	0.827	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0009056	0.991	catabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0006082	0.976	organic acid metabolic process
GO:0005996	0.976	monosaccharide metabolic process
GO:0044282	0.946	small molecule catabolic process
GO:0006793	0.938	phosphorus metabolic process
GO:0019637	0.927	organophosphate metabolic process
GO:0019321	0.921	pentose metabolic process
GO:0006796	0.918	phosphate-containing compound metabolic process
GO:1901135	0.913	carbohydrate derivative metabolic process
GO:0019752	0.887	carboxylic acid metabolic process
GO:0006091	0.872	generation of precursor metabolites and energy
GO:1901575	0.865	organic substance catabolic process
GO:1901576	0.823	organic substance biosynthetic process
GO:0016052	0.662	carbohydrate catabolic process
GO:0032787	0.594	monocarboxylic acid metabolic process
GO:0006807	0.560	nitrogen compound metabolic process
GO:0046365	0.402	monosaccharide catabolic process
GO:0090407	0.395	organophosphate biosynthetic process
GO:1901137	0.394	carbohydrate derivative biosynthetic process
GO:1901360	0.358	organic cyclic compound metabolic process
GO:0044248	0.357	cellular catabolic process
GO:0006725	0.342	cellular aromatic compound metabolic process
GO:0046483	0.337	heterocycle metabolic process
GO:0034641	0.337	cellular nitrogen compound metabolic process
GO:0006139	0.331	nucleobase-containing compound metabolic process
GO:1901564	0.330	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.855	membrane-bounded organelle
GO:0043231	0.831	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10964	1.000	ATP + D-xylulose = ADP + D-xylulose 5-phosphate + H(+)
EC:2.7.1.17	1.000	xylulokinase.

[back to server]