StarFunc result for job id O75197

User Input

>input (1615 residues)
MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVS
GLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGK
KLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAG
MDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHP
FALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCE
EDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTP
DFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGE
NPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTL
LEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV
GTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISL
ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYP
EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW
GGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV
IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ
DGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMI
PDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQ
NPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGY
LYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCD
LSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTG
IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE
ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS
PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP
GGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
PPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKAS
KYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QTJ4	0.829	0.829	0.000	1615	0.752	0.752	F1QTJ4.pdb.gz	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
2	AFDB:O75197	1.000	1.000	0.000	1615	1.000	1.000	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
3	AFDB:P98163	0.255	0.215	1.181E-73	1984	0.193	0.157	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
4	AFDB:Q6X0I2	0.296	0.273	3.129E-68	1782	0.180	0.163	Q6X0I2.pdb.gz	VGR_SOLIN Vitellogenin receptor OS=Solenopsis invicta OX=13686 GN=VgR PE=2 SV=1
5	AFDB:A0A140LH43	0.196	0.262	2.522E-58	1190	0.162	0.219	A0A140LH43.pdb.gz
6	AFDB:P01133	0.162	0.214	3.288E-57	1207	0.163	0.218	P01133.pdb.gz	EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2
7	AFDB:A8JRD0	0.188	0.282	6.403E-34	1076	0.081	0.122	A8JRD0.pdb.gz	A8JRD0_DROME Lipophorin receptor 1, isoform K OS=Drosophila melanogaster OX=7227 GN=LpR1 PE=4 SV=2
8	AFDB:D3ZE75	0.181	0.304	1.021E-32	953	0.076	0.128	D3ZE75.pdb.gz	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
9	AFDB:Q14114	0.182	0.302	1.528E-32	963	0.076	0.127	Q14114.pdb.gz	LRP8_HUMAN Low-density lipoprotein receptor-related protein 8 OS=Homo sapiens OX=9606 GN=LRP8 PE=1 SV=4
10	AFDB:Q9VBN2	0.188	0.295	1.777E-32	1028	0.080	0.125	Q9VBN2.pdb.gz	Q9VBN2_DROME Lipophorin receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=4
11	PDB:6jp6A	0.124	0.188	7.614E-20	998	0.069	0.112	6jp6A.pdb.gz
12	PDB:7mq8LO	0.133	0.234	7.825E-18	848	0.046	0.087	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuUL	0.108	0.215	8.229E-18	779	0.054	0.113	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7mq8LR	0.120	0.233	8.229E-18	773	0.048	0.100	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:1nr0A	0.138	0.338	1.842E-17	610	0.048	0.126	1nr0A.pdb.gz
16	PDB:7ajtUA	0.094	0.165	1.937E-17	834	0.056	0.109	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:5hxbY	0.103	0.146	3.727E-17	1080	0.069	0.103	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
18	PDB:2hyeA	0.111	0.151	5.576E-17	1140	0.073	0.104	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
19	PDB:7mq8LT	0.117	0.206	5.576E-17	869	0.044	0.082	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6xk9Y	0.115	0.161	6.167E-17	1106	0.062	0.090	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFD1	636	4752	0.283	0.096	A0A0B4KFD1_DROME LDL receptor protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=1
2	A0A0G2K0H3	2311	1613	0.697	0.698	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
3	A0A8I6AQY2	720	4469	0.288	0.104	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
4	A0A8I6G721	2957	1560	0.906	0.938	A0A8I6G721_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=3 SV=1
5	A1Z7C4	635	4730	0.283	0.097	A1Z7C4_DROME LDL receptor protein 1, isoform G OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=2
6	A1Z9D7	1270	1678	0.415	0.400	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
7	A2ARV4	662	4660	0.282	0.098	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
8	A8JTM7	619	4769	0.276	0.093	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
9	B2RYI1	3055	1600	0.930	0.939	B2RYI1_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=2 SV=1
10	B5L5I6	2185	1620	0.669	0.667	B5L5I6_DANRE Low-density lipoprotein receptor-related protein OS=Danio rerio OX=7955 GN=lrp6 PE=1 SV=1
11	C0HL13	658	4652	0.283	0.098	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
12	D0EWS1	2235	1430	0.668	0.755	D0EWS1_DANRE Low density lipoprotein-related protein 6 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
13	E0AE56	643	4673	0.286	0.099	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
14	E1BGJ0	793	4545	0.305	0.108	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
15	F1M443	719	4436	0.288	0.105	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
16	F1MAD0	2858	1473	0.858	0.941	F1MAD0_RAT LDL receptor related protein 5 OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=4 SV=3
17	F1QTJ4	2473	1615	0.742	0.742	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
18	F1QY34	783	4549	0.297	0.106	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
19	G3V928	786	4545	0.303	0.108	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
20	O75096	1019	1905	0.330	0.280	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01731 Arylesterase	0.0023	29.4	Arylesterase
2	PF16472 DUF5050	9.7e-18	75.9	Domain of unknown function (DUF5050)
3	PF14407 Frankia_peptide	7e+02	11.6	Ribosomally synthesized peptide prototyped by Frankia Franean1_4349.
4	PF14670 FXa_inhibition	5.3e-32	121.2	Coagulation Factor Xa inhibitory site
5	PF17870 Insulin_TMD	45	15.5	Insulin receptor trans-membrane segment
6	PF00057 Ldl_recept_a	1.1e-27	107.2	Low-density lipoprotein receptor domain class A
7	PF00058 Ldl_recept_b	1.5e-149	497.6	Low-density lipoprotein receptor repeat class B
8	PF01436 NHL	10	17.5	NHL repeat
9	PF08450 SGL	1.7e-12	59.1	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.999	Axin-1
2	9606.ENSP00000269141	0.999	Cadherin-2
3	9606.ENSP00000301691	0.999	Sclerostin
4	9606.ENSP00000363081	0.999	Dickkopf-related protein 1
5	9606.ENSP00000434034	0.999	Frizzled-4
6	9606.ENSP00000284523	0.998	Protein Wnt-3a
7	9606.ENSP00000293549	0.998	Proto-oncogene Wnt-1
8	9606.ENSP00000331242	0.997	Kremen protein 1
9	9606.ENSP00000344456	0.997	Catenin beta-1
10	9606.ENSP00000285311	0.994	Dickkopf-related protein 2
11	9606.ENSP00000220812	0.993	Dickkopf-related protein 4
12	9606.ENSP00000287934	0.989	Frizzled-1
13	9606.ENSP00000264634	0.988	Protein Wnt-5a
14	9606.ENSP00000341032	0.986	Protein Wnt-7b
15	9606.ENSP00000379762	0.986	Dickkopf-related protein 3
16	9606.ENSP00000426653	0.985	Protein Wnt-8a
17	9606.ENSP00000261758	0.981	LRP chaperone MESD
18	9606.ENSP00000290167	0.981	Protein Wnt-4
19	9606.ENSP00000272164	0.979	Protein Wnt-9a
20	9606.ENSP00000368169	0.978	Segment polarity protein dishevelled homolog DVL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0015026	0.994	coreceptor activity
GO:0071936	0.748	coreceptor activity involved in Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.987	cellular process
GO:0032502	0.985	developmental process
GO:0050789	0.985	regulation of biological process
GO:0048856	0.984	anatomical structure development
GO:0032501	0.983	multicellular organismal process
GO:0050794	0.983	regulation of cellular process
GO:0007275	0.962	multicellular organism development
GO:1905114	0.927	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0198738	0.925	cell-cell signaling by wnt
GO:0048731	0.912	system development
GO:0060070	0.906	canonical Wnt signaling pathway
GO:0048513	0.886	animal organ development
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0048518	0.860	positive regulation of biological process
GO:0048522	0.854	positive regulation of cellular process
GO:0060255	0.835	regulation of macromolecule metabolic process
GO:0080090	0.822	regulation of primary metabolic process
GO:0042221	0.819	response to chemical
GO:0048519	0.767	negative regulation of biological process
GO:0009653	0.756	anatomical structure morphogenesis
GO:0031323	0.745	regulation of cellular metabolic process
GO:0009719	0.743	response to endogenous stimulus
GO:0048880	0.728	sensory system development
GO:0010033	0.714	response to organic substance
GO:0048523	0.694	negative regulation of cellular process
GO:0009893	0.673	positive regulation of metabolic process
GO:1901700	0.671	response to oxygen-containing compound
GO:1901698	0.659	response to nitrogen compound
GO:0043434	0.646	response to peptide hormone
GO:0007423	0.644	sensory organ development
GO:0010604	0.610	positive regulation of macromolecule metabolic process
GO:0042127	0.544	regulation of cell population proliferation
GO:0009889	0.542	regulation of biosynthetic process
GO:0009628	0.538	response to abiotic stimulus
GO:0010468	0.526	regulation of gene expression
GO:0060041	0.508	retina development in camera-type eye
GO:0019219	0.498	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.492	regulation of cellular biosynthetic process
GO:0051252	0.492	regulation of RNA metabolic process
GO:0010556	0.491	regulation of macromolecule biosynthetic process
GO:0050793	0.480	regulation of developmental process
GO:2001141	0.480	regulation of RNA biosynthetic process
GO:0023051	0.476	regulation of signaling
GO:0065009	0.472	regulation of molecular function
GO:0006355	0.464	regulation of DNA-templated transcription
GO:0051173	0.463	positive regulation of nitrogen compound metabolic process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0001944	0.448	vasculature development
GO:0008152	0.441	metabolic process
GO:0048583	0.431	regulation of response to stimulus
GO:0010646	0.430	regulation of cell communication
GO:0009891	0.410	positive regulation of biosynthetic process
GO:0051246	0.396	regulation of protein metabolic process
GO:0045893	0.390	positive regulation of DNA-templated transcription
GO:0009892	0.388	negative regulation of metabolic process
GO:0051174	0.383	regulation of phosphorus metabolic process
GO:0031399	0.378	regulation of protein modification process
GO:0051172	0.359	negative regulation of nitrogen compound metabolic process
GO:0019220	0.358	regulation of phosphate metabolic process
GO:0045595	0.354	regulation of cell differentiation
GO:0050790	0.348	regulation of catalytic activity
GO:0010605	0.348	negative regulation of macromolecule metabolic process
GO:0042325	0.343	regulation of phosphorylation
GO:0009888	0.333	tissue development
GO:0051094	0.333	positive regulation of developmental process
GO:0030154	0.315	cell differentiation
GO:0009966	0.308	regulation of signal transduction
GO:0031324	0.303	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0012505	0.992	endomembrane system
GO:0032991	0.980	protein-containing complex
GO:0031982	0.927	vesicle
GO:0005576	0.875	extracellular region
GO:0031410	0.843	cytoplasmic vesicle
GO:0098796	0.553	membrane protein complex
GO:0098797	0.435	plasma membrane protein complex
GO:0043235	0.420	receptor complex
GO:0031090	0.417	organelle membrane
GO:0098588	0.387	bounding membrane of organelle
GO:1990851	0.386	Wnt-Frizzled-LRP5/6 complex
GO:0005768	0.379	endosome
GO:0005739	0.364	mitochondrion
GO:0030054	0.328	cell junction
GO:0005769	0.326	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]