StarFunc result for job id O75204

User Input

>input (238 residues)
MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGT
CSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKH
PALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLV
AGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75204	1.000	1.000	3.892E-37	238	1.000	1.000	O75204.pdb.gz	TM127_HUMAN Transmembrane protein 127 OS=Homo sapiens OX=9606 GN=TMEM127 PE=1 SV=1
2	AFDB:Q99PA5	0.426	0.569	7.330E-5	165	0.134	0.194	Q99PA5.pdb.gz	NKG7_MOUSE Protein NKG7 OS=Mus musculus OX=10090 GN=Nkg7 PE=2 SV=1
3	AFDB:Q16617	0.469	0.649	1.101E-4	165	0.126	0.182	Q16617.pdb.gz	NKG7_HUMAN Protein NKG7 OS=Homo sapiens OX=9606 GN=NKG7 PE=1 SV=1
4	AFDB:Q9N419	0.530	0.428	1.494E-4	303	0.126	0.099	Q9N419.pdb.gz	Q9N419_CAEEL Clc-like protein OS=Caenorhabditis elegans OX=6239 GN=nsy-4 PE=1 SV=3
5	AFDB:O76899	0.425	0.401	3.204E-4	256	0.164	0.152	O76899.pdb.gz	O76899_DROME EG:80H7.2 protein OS=Drosophila melanogaster OX=7227 GN=pck PE=4 SV=1
6	AFDB:B1AQL3	0.511	0.570	3.371E-4	211	0.151	0.171	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
7	AFDB:Q8NCR9	0.528	0.553	3.371E-4	226	0.143	0.150	Q8NCR9.pdb.gz	CLRN3_HUMAN Clarin-3 OS=Homo sapiens OX=9606 GN=CLRN3 PE=1 SV=1
8	AFDB:P62955	0.476	0.418	3.547E-4	275	0.168	0.145	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
9	AFDB:O60359	0.415	0.333	3.927E-4	315	0.122	0.092	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
10	AFDB:Q8VHW8	0.510	0.449	4.132E-4	275	0.130	0.113	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
11	PDB:7rz4A	0.497	0.136	1.978E-3	993	0.109	0.026	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:6ov2A	0.479	0.607	3.642E-3	182	0.122	0.159	6ov2A.pdb.gz
13	PDB:7rzaA	0.437	0.131	4.697E-3	981	0.097	0.023	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:7ocaI	0.310	0.380	6.706E-3	185	0.092	0.119	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
15	PDB:5b2gC	0.424	0.306	1.675E-2	350	0.130	0.089	5b2gC.pdb.gz
16	PDB:7d3eB	0.452	0.401	3.085E-2	272	0.109	0.096	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
17	PDB:5kbtA	0.427	0.124	5.679E-2	973	0.109	0.027	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
18	PDB:5weoA	0.294	0.100	5.976E-2	988	0.101	0.024	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:6jp5E	0.385	0.513	7.706E-2	169	0.105	0.148	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
20	PDB:6wxuB	0.467	0.414	9.938E-2	273	0.118	0.103	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75204	1.55e-176	486	238	1.000	1.000	TM127_HUMAN Transmembrane protein 127 OS=Homo sapiens OX=9606 GN=TMEM127 PE=1 SV=1
2	Q8BGP5	1.38e-174	481	238	0.987	0.987	TM127_MOUSE Transmembrane protein 127 OS=Mus musculus OX=10090 GN=Tmem127 PE=2 SV=1
3	Q6NP69	6.3	30.4	1045	0.038	0.009	Q6NP69_DROME GST-containing FLYWCH zinc-finger protein OS=Drosophila melanogaster OX=7227 GN=gfzf PE=1 SV=1
4	Q97SJ0	7.7	29.6	175	0.097	0.131	Y371_STRPN UPF0398 protein SP_0371 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0371 PE=1 SV=1
5	A0FGR8	8.3	30.0	921	0.084	0.022	ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20517 TMEM127	1.3e-33	126.7	Transmembrane protein 127

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000008921

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000014053	0.672	Succinate dehydrogenase assembly factor 2, mitochondrial
2	9668.ENSMPUP00000006805	0.666	MYC associated factor X
3	9668.ENSMPUP00000007050	0.645	MAX dimerization protein 1
4	9668.ENSMPUP00000010251	0.637	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
5	9668.ENSMPUP00000017168	0.636	Proto-oncogene tyrosine-protein kinase receptor Ret
6	9668.ENSMPUP00000006946	0.611	ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
7	9668.ENSMPUP00000008907	0.580	Probable cytosolic iron-sulfur protein assembly protein CIAO1
8	9668.ENSMPUP00000014319	0.570	Neurofibromin 1
9	9668.ENSMPUP00000014332	0.563	Succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
10	9668.ENSMPUP00000011225	0.560	Filamin A interacting protein 1-like
11	9668.ENSMPUP00000016349	0.545	Kinesin family member 1B
12	9668.ENSMPUP00000003615	0.541	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
13	9668.ENSMPUP00000016144	0.541	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
14	9668.ENSMPUP00000011927	0.527	Endothelial PAS domain protein 1
15	9668.ENSMPUP00000011043	0.525	Casein kinase 1, delta
16	9668.ENSMPUP00000018521	0.519	Inositol 1,4,5-trisphosphate receptor interacting protein-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.955	cellular process
GO:0048523	0.951	negative regulation of cellular process
GO:0023051	0.935	regulation of signaling
GO:0010646	0.935	regulation of cell communication
GO:0048583	0.932	regulation of response to stimulus
GO:1902531	0.876	regulation of intracellular signal transduction
GO:0009968	0.869	negative regulation of signal transduction
GO:0032006	0.853	regulation of TOR signaling
GO:0042127	0.678	regulation of cell population proliferation
GO:0071840	0.457	cellular component organization or biogenesis
GO:0016043	0.447	cellular component organization
GO:0008152	0.388	metabolic process
GO:0006996	0.324	organelle organization
GO:0071704	0.312	organic substance metabolic process
GO:0016050	0.302	vesicle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005768	0.996	endosome
GO:0005769	0.993	early endosome
GO:0032991	0.896	protein-containing complex
GO:0031090	0.703	organelle membrane
GO:0098796	0.605	membrane protein complex
GO:0098588	0.419	bounding membrane of organelle
GO:0098797	0.404	plasma membrane protein complex
GO:0098590	0.347	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]