StarFunc result for job id O75208

User Input

>input (318 residues)
MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQ
QHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEA
IAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQ
FLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNW
YTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQG
LMGAAVTLKNLTGLNQRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75208	1.000	1.000	1.317E-40	318	1.000	1.000	O75208.pdb.gz	COQ9_HUMAN Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens OX=9606 GN=COQ9 PE=1 SV=1
2	PDB:6awlA	0.611	0.885	4.671E-27	217	0.679	0.995	6awlA.pdb.gz
3	AFDB:F4IE14	0.590	0.600	5.577E-15	312	0.267	0.272	F4IE14.pdb.gz	F4IE14_ARATH Ubiquinone biosynthesis protein OS=Arabidopsis thaliana OX=3702 GN=COQ9 PE=1 SV=1
4	AFDB:O13850	0.568	0.711	6.018E-11	250	0.211	0.268	O13850.pdb.gz	COQ9_SCHPO Ubiquinone biosynthesis protein coq9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq9 PE=3 SV=1
5	AFDB:O88387	0.153	0.085	2.715E-2	766	0.145	0.060	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
6	PDB:3vprA	0.335	0.494	3.303E-2	189	0.113	0.190	3vprA.pdb.gz
7	AFDB:Q9LK65	0.124	0.071	4.851E-2	661	0.138	0.067	Q9LK65.pdb.gz	Y3307_ARATH Putative DUF21 domain-containing protein At3g13070, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CBSDUFCH1 PE=4 SV=1
8	PDB:3mnlA	0.432	0.668	4.863E-2	188	0.094	0.160	3mnlA.pdb.gz
9	AFDB:A0AVG3	0.204	0.139	5.343E-2	514	0.157	0.097	A0AVG3.pdb.gz	A0AVG3_HUMAN t-SNARE domain containing 1 OS=Homo sapiens OX=9606 GN=TSNARE1 PE=1 SV=1
10	PDB:6z1bB	0.269	0.360	6.823E-2	202	0.107	0.168	6z1bB.pdb.gz	Structure of K52-acetylated RutR in complex with uracil.
11	PDB:7ky1A	0.359	0.522	6.823E-2	189	0.104	0.175	7ky1A.pdb.gz
12	AFDB:Q8BSY0	0.139	0.082	8.258E-2	741	0.126	0.054	Q8BSY0.pdb.gz	ASPH_MOUSE Aspartyl/asparaginyl beta-hydroxylase OS=Mus musculus OX=10090 GN=Asph PE=1 SV=1
13	AFDB:Q9SI74	0.166	0.168	9.097E-2	312	0.094	0.096	Q9SI74.pdb.gz	PMI10_ARATH Pectinesterase inhibitor 10 OS=Arabidopsis thaliana OX=3702 GN=PMEI10 PE=2 SV=1
14	AFDB:F1NW90	0.152	0.080	1.052E-1	823	0.138	0.053	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
15	AFDB:Q5JSP0	0.133	0.079	1.104E-1	725	0.142	0.062	Q5JSP0.pdb.gz	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
16	PDB:2fd5A	0.316	0.479	1.219E-1	180	0.085	0.150	2fd5A.pdb.gz
17	PDB:7acoB	0.315	0.475	1.630E-1	180	0.110	0.194	7acoB.pdb.gz
18	PDB:2jj7B	0.239	0.367	1.710E-1	183	0.091	0.158	2jj7B.pdb.gz
19	PDB:6hrzB	0.338	0.474	2.075E-1	202	0.085	0.134	6hrzB.pdb.gz	A fragment-based approach towards the discovery of N-substituted tropinones as inhibitors of Mycobacterium tuberculosis transcriptional regulator EthR2.
20	PDB:2fbqA	0.241	0.329	2.912E-1	213	0.085	0.127	2fbqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75208	0.0	661	318	1.000	1.000	COQ9_HUMAN Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens OX=9606 GN=COQ9 PE=1 SV=1
2	Q8K1Z0	0.0	567	313	0.906	0.920	COQ9_MOUSE Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Mus musculus OX=10090 GN=Coq9 PE=1 SV=1
3	F4IE14	3.22e-41	147	312	0.289	0.295	F4IE14_ARATH Ubiquinone biosynthesis protein OS=Arabidopsis thaliana OX=3702 GN=COQ9 PE=1 SV=1
4	O13850	1.19e-29	115	250	0.211	0.268	COQ9_SCHPO Ubiquinone biosynthesis protein coq9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq9 PE=3 SV=1
5	Q05779	6.34e-12	67.0	260	0.160	0.196	COQ9_YEAST Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ9 PE=1 SV=1
6	F4KAK5	3.9	32.0	635	0.069	0.035	PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana OX=3702 GN=PSD2 PE=2 SV=1
7	Q10216	8.0	30.4	286	0.063	0.070	YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.08 PE=3 SV=1
8	A1Z877	8.6	30.8	1350	0.047	0.011	NDG_DROME Nidogen OS=Drosophila melanogaster OX=7227 GN=Ndg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08511 COQ9	2e-32	122.1	COQ9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322316	0.996	5-demethoxyubiquinone hydroxylase, mitochondrial
2	9606.ENSP00000254759	0.992	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
3	9606.ENSP00000300452	0.986	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
4	9606.ENSP00000333946	0.981	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
5	9606.ENSP00000288532	0.974	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
6	9606.ENSP00000365388	0.971	Decaprenyl-diphosphate synthase subunit 1
7	9606.ENSP00000355741	0.967	Atypical kinase COQ8A, mitochondrial
8	9606.ENSP00000315118	0.965	Atypical kinase COQ8B, mitochondrial
9	9606.ENSP00000310873	0.947	4-hydroxybenzoate polyprenyltransferase, mitochondrial
10	9606.ENSP00000358033	0.918	Decaprenyl-diphosphate synthase subunit 2
11	9606.ENSP00000426638	0.811	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
12	9606.ENSP00000312587	0.772	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
13	9606.ENSP00000306397	0.767	Cytochrome b-c1 complex subunit Rieske, mitochondrial
14	9606.ENSP00000285928	0.753	Leucine-rich repeat and guanylate kinase domain-containing protein
15	9606.ENSP00000405482	0.749	Putative transporter SVOPL
16	9606.ENSP00000263985	0.737	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
17	9606.ENSP00000400806	0.730	Aprataxin
18	9606.ENSP00000263960	0.722	Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
19	9606.ENSP00000266544	0.719	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
20	9606.ENSP00000364649	0.719	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0015980	0.989	energy derivation by oxidation of organic compounds
GO:0006119	0.978	oxidative phosphorylation
GO:0044281	0.972	small molecule metabolic process
GO:0022904	0.966	respiratory electron transport chain
GO:1901576	0.964	organic substance biosynthetic process
GO:0044249	0.963	cellular biosynthetic process
GO:0019646	0.956	aerobic electron transport chain
GO:0042775	0.956	mitochondrial ATP synthesis coupled electron transport
GO:0006744	0.907	ubiquinone biosynthetic process
GO:0006120	0.889	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0032991	0.995	protein-containing complex
GO:0016020	0.994	membrane
GO:0031090	0.977	organelle membrane
GO:0005743	0.974	mitochondrial inner membrane
GO:0070013	0.875	intracellular organelle lumen
GO:0110142	0.391	ubiquinone biosynthesis complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]