StarFunc result for job id O75251

User Input

>input (213 residues)
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG
EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM
IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI
PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75251	1.000	1.000	1.834E-43	213	1.000	1.000	O75251.pdb.gz	NDUS7_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS7 PE=1 SV=3
2	AFDB:P42026	0.751	0.740	6.420E-39	216	0.873	0.861	P42026.pdb.gz	NDUS7_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS7 PE=1 SV=1
3	AFDB:Q9DC70	0.743	0.708	1.736E-37	224	0.869	0.826	Q9DC70.pdb.gz	NDUS7_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs7 PE=1 SV=1
4	AFDB:Q42577	0.745	0.727	4.427E-33	218	0.629	0.615	Q42577.pdb.gz	NDUS7_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g11770 PE=1 SV=1
5	AFDB:Q9VXK7	0.750	0.723	6.079E-33	221	0.638	0.615	Q9VXK7.pdb.gz	Q9VXK7_DROME LD31474p OS=Drosophila melanogaster OX=7227 GN=ND-20 PE=1 SV=1
6	AFDB:Q94360	0.748	0.800	5.844E-31	199	0.601	0.643	Q94360.pdb.gz	NDUS7_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nduf-7 PE=3 SV=1
7	AFDB:Q9VAK5	0.749	0.752	9.706E-31	212	0.648	0.651	Q9VAK5.pdb.gz	Q9VAK5_DROME NADH dehydrogenase (Ubiquinone) 20 kDa subunit-like, isoform A OS=Drosophila melanogaster OX=7227 GN=ND-20L PE=3 SV=1
8	PDB:7qsoB	0.724	0.974	2.781E-30	158	0.718	0.968	7qsoB.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
9	AFDB:Q5ADP7	0.743	0.710	3.450E-30	223	0.563	0.538	Q5ADP7.pdb.gz	Q5ADP7_CANAL Fesur1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FESUR1 PE=3 SV=1
10	PDB:7aqrB	0.719	0.973	1.331E-28	157	0.573	0.777	7aqrB.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
11	AFDB:Q387C0	0.688	0.723	1.064E-25	202	0.432	0.455	Q387C0.pdb.gz	Q387C0_TRYB2 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0017 PE=3 SV=1
12	AFDB:O98679	0.667	0.626	2.766E-22	227	0.357	0.335	O98679.pdb.gz	NDHK_PEA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Pisum sativum OX=3888 GN=ndhK PE=1 SV=1
13	PDB:7nyrB	0.566	0.750	2.504E-15	159	0.329	0.440	7nyrB.pdb.gz	Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
14	PDB:6cfwJ	0.572	0.839	1.544E-13	143	0.225	0.336	6cfwJ.pdb.gz	Structure of an Ancient Respiratory System.
15	PDB:7wfgK	0.581	0.732	6.232E-13	167	0.315	0.401	7wfgK.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
16	PDB:7z0sG	0.567	0.486	1.175E-12	250	0.235	0.200	7z0sG.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
17	PDB:7odgS	0.398	0.325	7.310E-5	270	0.127	0.100	7odgS.pdb.gz	Resonance Raman spectroscopic analysis of the iron-sulfur cluster redox chain of the Ralstonia eutropha membrane-bound [NiFe]-hydrogenase
18	PDB:4gd3S	0.429	0.314	4.316E-4	304	0.108	0.076	4gd3S.pdb.gz	Crystal Structure of the O(2)-Tolerant Membrane-Bound Hydrogenase 1 from Escherichia coli in Complex with Its Cognate Cytochrome b.
19	PDB:5jshA	0.446	0.346	1.977E-3	283	0.117	0.088	5jshA.pdb.gz	The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
20	PDB:1qo0E	0.398	0.429	7.978E-3	194	0.066	0.072	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75251	3.24e-157	435	213	1.000	1.000	NDUS7_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS7 PE=1 SV=3
2	P42026	1.92e-133	375	216	0.850	0.838	NDUS7_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS7 PE=1 SV=1
3	A0A8I6AES7	9.67e-127	358	218	0.850	0.830	A0A8I6AES7_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs7 PE=1 SV=1
4	Q9DC70	2.72e-126	357	224	0.864	0.821	NDUS7_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs7 PE=1 SV=1
5	F7ELE5	9.78e-113	325	272	0.728	0.570	F7ELE5_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs7 PE=1 SV=1
6	Q9VXK7	8.27e-102	295	221	0.606	0.584	Q9VXK7_DROME LD31474p OS=Drosophila melanogaster OX=7227 GN=ND-20 PE=1 SV=1
7	Q9VAK5	3.85e-100	290	212	0.610	0.613	Q9VAK5_DROME NADH dehydrogenase (Ubiquinone) 20 kDa subunit-like, isoform A OS=Drosophila melanogaster OX=7227 GN=ND-20L PE=3 SV=1
8	Q94360	2.13e-98	286	199	0.573	0.613	NDUS7_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nduf-7 PE=3 SV=1
9	Q42577	1.02e-95	280	218	0.577	0.564	NDUS7_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g11770 PE=1 SV=1
10	Q5ADP7	3.40e-93	273	223	0.545	0.520	Q5ADP7_CANAL Fesur1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FESUR1 PE=3 SV=1
11	Q387C0	1.79e-67	207	202	0.418	0.441	Q387C0_TRYB2 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0017 PE=3 SV=1
12	O98679	4.50e-55	177	227	0.343	0.322	NDHK_PEA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Pisum sativum OX=3888 GN=ndhK PE=1 SV=1
13	P56756	7.13e-55	176	225	0.343	0.324	NDHK_ARATH NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhK PE=1 SV=1
14	P0AFC7	8.40e-55	176	220	0.376	0.364	NUOB_ECOLI NADH-quinone oxidoreductase subunit B OS=Escherichia coli (strain K12) OX=83333 GN=nuoB PE=1 SV=1
15	P0C341	9.25e-55	176	225	0.343	0.324	NDHK_ORYSA NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa OX=4530 GN=ndhK PE=3 SV=2
16	P0C342	9.25e-55	176	225	0.343	0.324	NDHK_ORYSI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhK PE=3 SV=2
17	P0C343	9.25e-55	176	225	0.343	0.324	NDHK_ORYSJ NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhK PE=3 SV=2
18	Q6ENH0	9.25e-55	176	225	0.343	0.324	NDHK_ORYNI NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Oryza nivara OX=4536 GN=ndhK PE=3 SV=2
19	Q8U0Z8	4.17e-30	111	167	0.211	0.269	MBHJ_PYRFU Probable membrane-bound hydrogenase subunit mbhJ OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mbhJ PE=1 SV=1
20	P16433	3.39e-27	105	255	0.230	0.192	HYCG_ECOLI Formate hydrogenlyase subunit 7 OS=Escherichia coli (strain K12) OX=83333 GN=hycG PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01058 Oxidored_q6	4.8e-19	79.9	NADH ubiquinone oxidoreductase, 20 Kd subunit
2	PF17521 Secapin	3.2e+02	12.7	Honey bee peptides

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233627

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000237889	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
12	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
13	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
14	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
15	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
16	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
17	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
18	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
19	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
20	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003955	0.997	NAD(P)H dehydrogenase (quinone) activity
GO:0015453	0.996	oxidoreduction-driven active transmembrane transporter activity
GO:0009055	0.995	electron transfer activity
GO:0008137	0.991	NADH dehydrogenase (ubiquinone) activity
GO:0002020	0.460	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0032981	0.977	mitochondrial respiratory chain complex I assembly
GO:0022904	0.975	respiratory electron transport chain
GO:0042775	0.956	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.955	aerobic electron transport chain
GO:0006120	0.949	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0032991	0.996	protein-containing complex
GO:0070013	0.993	intracellular organelle lumen
GO:0043227	0.991	membrane-bounded organelle
GO:0005739	0.984	mitochondrion
GO:1902494	0.971	catalytic complex
GO:0031090	0.967	organelle membrane
GO:0031966	0.963	mitochondrial membrane
GO:1990204	0.962	oxidoreductase complex
GO:0019866	0.956	organelle inner membrane
GO:0005743	0.953	mitochondrial inner membrane
GO:0098800	0.931	inner mitochondrial membrane protein complex
GO:0005759	0.927	mitochondrial matrix
GO:0070469	0.915	respirasome
GO:0005746	0.913	mitochondrial respirasome
GO:0098803	0.890	respiratory chain complex
GO:0005886	0.884	plasma membrane
GO:0045271	0.855	respiratory chain complex I
GO:0005747	0.839	mitochondrial respiratory chain complex I
GO:0031981	0.505	nuclear lumen
GO:0005654	0.469	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.5.2	0.997	NAD(P)H dehydrogenase (quinone).
EC:7.-.-.-	0.996	Translocases.
RHEA:29091	0.991	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.991	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]