StarFunc result for job id O75293

User Input

>input (160 residues)
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75293	1.000	1.000	5.255E-32	160	1.000	1.000	O75293.pdb.gz	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
2	AFDB:Q6PC51	0.947	0.953	4.233E-25	159	0.688	0.692	Q6PC51.pdb.gz	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
3	AFDB:Q5NU21	0.940	0.952	9.321E-24	158	0.694	0.703	Q5NU21.pdb.gz	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
4	AFDB:P24522	0.917	0.890	1.811E-20	165	0.575	0.558	P24522.pdb.gz	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
5	AFDB:F1R8Z0	0.912	0.928	2.818E-20	157	0.537	0.548	F1R8Z0.pdb.gz	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
6	AFDB:O95257	0.869	0.875	2.565E-19	159	0.550	0.553	O95257.pdb.gz	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
7	PDB:2walA	0.814	0.871	3.015E-17	149	0.525	0.564	2walA.pdb.gz
8	PDB:2kg4A	0.793	0.771	2.577E-16	165	0.537	0.521	2kg4A.pdb.gz
9	AFDB:A0A087WZQ0	0.718	0.776	1.328E-12	147	0.500	0.544	A0A087WZQ0.pdb.gz	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
10	AFDB:A1Z6W5	0.716	0.704	2.662E-10	163	0.219	0.215	A1Z6W5.pdb.gz	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
11	AFDB:P25398	0.586	0.698	3.435E-6	132	0.175	0.212	P25398.pdb.gz	RS12_HUMAN Small ribosomal subunit protein eS12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3
12	PDB:6fecr	0.515	0.637	1.953E-5	124	0.169	0.218	6fecr.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
13	AFDB:Q38AC1	0.573	0.639	2.430E-5	142	0.156	0.176	Q38AC1.pdb.gz	Q38AC1_TRYB2 40S ribosomal protein S12 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2050 PE=3 SV=1
14	PDB:6faiM	0.546	0.679	7.829E-5	125	0.138	0.176	6faiM.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
15	PDB:2aleA	0.579	0.688	8.882E-5	132	0.150	0.182	2aleA.pdb.gz	Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
16	PDB:5fciC2	0.481	0.601	1.894E-4	124	0.163	0.210	5fciC2.pdb.gz	?
17	PDB:5y7mA	0.509	0.629	3.138E-4	125	0.131	0.168	5y7mA.pdb.gz	Crystal structures of the archaeal RNase P protein Rpp38 in complex with RNA fragments containing a K-turn motif.
18	PDB:3sivA	0.574	0.700	3.792E-4	128	0.144	0.180	3sivA.pdb.gz	Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
19	PDB:4v6wCG	0.453	0.320	8.612E-4	241	0.131	0.087	4v6wCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:7zjwB	0.557	0.450	1.181E-3	204	0.144	0.113	7zjwB.pdb.gz	Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75293	3.77e-117	329	160	1.000	1.000	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
2	P22339	9.13e-108	305	160	0.931	0.931	GA45B_MOUSE Growth arrest and DNA damage-inducible protein GADD45 beta OS=Mus musculus OX=10090 GN=Gadd45b PE=1 SV=1
3	Q6PC51	1.88e-76	226	159	0.688	0.692	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
4	Q5NU21	3.78e-75	223	158	0.700	0.709	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
5	P48316	1.59e-62	191	165	0.581	0.564	GA45A_MOUSE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Mus musculus OX=10090 GN=Gadd45a PE=1 SV=1
6	P48317	2.63e-62	191	165	0.581	0.564	GA45A_RAT Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Rattus norvegicus OX=10116 GN=Gadd45a PE=2 SV=1
7	P24522	6.02e-61	187	165	0.575	0.558	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
8	O95257	4.03e-57	177	159	0.556	0.560	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
9	Q9Z111	5.03e-56	174	159	0.550	0.553	GA45G_MOUSE Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Mus musculus OX=10090 GN=Gadd45g PE=1 SV=1
10	F1R8Z0	4.16e-55	172	157	0.550	0.561	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
11	A0A087WZQ0	2.10e-47	152	147	0.500	0.544	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
12	Q8MYS8	1.42e-08	53.1	163	0.144	0.141	Q8MYS8_DROME RH70774p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
13	A1Z6W5	1.48e-08	53.1	163	0.144	0.141	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
14	A5JUZ3	8.93e-08	48.5	60	0.156	0.417	A5JUZ3_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
15	P25398	5.90e-04	40.0	132	0.163	0.197	RS12_HUMAN Small ribosomal subunit protein eS12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3
16	P63323	5.90e-04	40.0	132	0.163	0.197	RS12_MOUSE Small ribosomal subunit protein eS12 OS=Mus musculus OX=10090 GN=Rps12 PE=1 SV=3
17	O35505	4.0	30.0	2169	0.106	0.008	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
18	P22002	8.6	29.3	2169	0.106	0.008	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
19	Q01815	8.6	29.3	2139	0.106	0.008	CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus OX=10090 GN=Cacna1c PE=1 SV=1
20	Q2UEI4	9.8	28.9	538	0.138	0.041	Q2UEI4_ASPOR PX domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090026000605 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01248 Ribosomal_L7Ae	3.7e-15	66.7	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000000329

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000004070	0.990	Mitogen-activated protein kinase kinase kinase 4
2	30611.ENSOGAP00000017004	0.938	Proliferating cell nuclear antigen
3	30611.ENSOGAP00000015106	0.923	Cellular tumor antigen p53
4	30611.ENSOGAP00000001916	0.911	Growth arrest and DNA-damage-inducible, gamma
5	30611.ENSOGAP00000008901	0.879	Belongs to the protein kinase superfamily.
6	30611.ENSOGAP00000020029	0.879	Uncharacterized protein
7	30611.ENSOGAP00000011548	0.865	Cyclin B2
8	30611.ENSOGAP00000019971	0.848	Growth arrest and DNA-damage-inducible, alpha
9	30611.ENSOGAP00000002786	0.841	Cyclin B3
10	30611.ENSOGAP00000011532	0.779	Mitogen-activated protein kinase kinase 7
11	30611.ENSOGAP00000001928	0.682	Uncharacterized protein
12	30611.ENSOGAP00000016301	0.682	Uncharacterized protein
13	30611.ENSOGAP00000016334	0.682	Uncharacterized protein
14	30611.ENSOGAP00000018314	0.682	Uncharacterized protein
15	30611.ENSOGAP00000021393	0.682	Uncharacterized protein
16	30611.ENSOGAP00000003993	0.668	Belongs to the protein kinase superfamily.
17	30611.ENSOGAP00000003725	0.661	CCR4-NOT transcription complex subunit 9
18	30611.ENSOGAP00000009312	0.648	Belongs to the protein kinase superfamily.
19	30611.ENSOGAP00000020878	0.575	Neurensin 1
20	30611.ENSOGAP00000015235	0.550	thymine-DNA glycosylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.420	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0048519	0.960	negative regulation of biological process
GO:0048583	0.959	regulation of response to stimulus
GO:0080090	0.922	regulation of primary metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0051174	0.915	regulation of phosphorus metabolic process
GO:0048522	0.911	positive regulation of cellular process
GO:0009966	0.910	regulation of signal transduction
GO:0042325	0.899	regulation of phosphorylation
GO:0048584	0.892	positive regulation of response to stimulus
GO:1902531	0.886	regulation of intracellular signal transduction
GO:0009987	0.882	cellular process
GO:1902533	0.879	positive regulation of intracellular signal transduction
GO:0043408	0.871	regulation of MAPK cascade
GO:0048523	0.844	negative regulation of cellular process
GO:0043065	0.839	positive regulation of apoptotic process
GO:0065009	0.837	regulation of molecular function
GO:0043410	0.828	positive regulation of MAPK cascade
GO:0080135	0.814	regulation of cellular response to stress
GO:0051338	0.813	regulation of transferase activity
GO:0050896	0.768	response to stimulus
GO:0009892	0.678	negative regulation of metabolic process
GO:0010605	0.671	negative regulation of macromolecule metabolic process
GO:0051246	0.669	regulation of protein metabolic process
GO:0051172	0.664	negative regulation of nitrogen compound metabolic process
GO:0031324	0.663	negative regulation of cellular metabolic process
GO:0032874	0.642	positive regulation of stress-activated MAPK cascade
GO:0009893	0.640	positive regulation of metabolic process
GO:0031399	0.512	regulation of protein modification process
GO:0010468	0.506	regulation of gene expression
GO:0001932	0.435	regulation of protein phosphorylation
GO:0051716	0.432	cellular response to stimulus
GO:0043086	0.418	negative regulation of catalytic activity
GO:0045936	0.418	negative regulation of phosphate metabolic process
GO:0051248	0.416	negative regulation of protein metabolic process
GO:0010556	0.403	regulation of macromolecule biosynthetic process
GO:1900744	0.386	regulation of p38MAPK cascade
GO:0031400	0.377	negative regulation of protein modification process
GO:0031326	0.363	regulation of cellular biosynthetic process
GO:0010604	0.363	positive regulation of macromolecule metabolic process
GO:0042326	0.356	negative regulation of phosphorylation
GO:0019219	0.351	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.346	metabolic process
GO:0051348	0.344	negative regulation of transferase activity
GO:0051252	0.344	regulation of RNA metabolic process
GO:0051173	0.338	positive regulation of nitrogen compound metabolic process
GO:0032502	0.337	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.991	cytoplasm
GO:0070013	0.945	intracellular organelle lumen
GO:0031981	0.942	nuclear lumen
GO:0005654	0.881	nucleoplasm
GO:0005829	0.437	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]