StarFunc result for job id O75298

User Input

>input (545 residues)
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPR
ELTFSYIAFDGVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPE
PGRRGDPDTAPPSERPLEDLRLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLE
TGEAGEELDLRLRLAQPSSPEVLTPQLSPGSGTPQAGTPSPSRSRDSNSGPEEPLLEEEE
KQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKTSLLLAVYKTVPILELSPPLW
TAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLYWKDTRTSGVV
FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD
LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTL
LILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGS
KAKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75298	0.999	0.999	3.895E-75	545	1.000	1.000	O75298.pdb.gz	RTN2_HUMAN Reticulon-2 OS=Homo sapiens OX=9606 GN=RTN2 PE=1 SV=1
2	AFDB:Q4G5U8	0.162	0.116	1.220E-14	780	0.262	0.183	Q4G5U8.pdb.gz
3	AFDB:Q9JK11	0.218	0.117	2.169E-14	1163	0.250	0.117	Q9JK11.pdb.gz	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
4	AFDB:A0A0R4IF59	0.178	0.185	2.800E-14	523	0.235	0.245	A0A0R4IF59.pdb.gz	A0A0R4IF59_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn6 PE=1 SV=1
5	AFDB:Q4G5U4	0.100	0.075	4.925E-11	753	0.224	0.162	Q4G5U4.pdb.gz
6	AFDB:Q4G5U2	0.098	0.079	4.013E-7	685	0.196	0.156	Q4G5U2.pdb.gz
7	AFDB:Q9FH18	0.097	0.103	9.145E-5	509	0.141	0.151	Q9FH18.pdb.gz	WIP2_ARATH WPP domain-interacting protein 2 OS=Arabidopsis thaliana OX=3702 GN=WIP2 PE=1 SV=1
8	AFDB:Q6P2H3	0.072	0.056	3.077E-4	762	0.154	0.110	Q6P2H3.pdb.gz	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
9	AFDB:Q8GXA4	0.081	0.088	5.468E-4	489	0.132	0.147	Q8GXA4.pdb.gz	WIP1_ARATH WPP domain-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=WIP1 PE=1 SV=1
10	AFDB:Q8N715	0.090	0.082	1.254E-3	623	0.167	0.146	Q8N715.pdb.gz	CC185_HUMAN Coiled-coil domain-containing protein 185 OS=Homo sapiens OX=9606 GN=CCDC185 PE=1 SV=2
11	PDB:2p01A	0.076	0.114	4.095	323	0.050	0.084	2p01A.pdb.gz
12	PDB:6gmlU	0.039	0.091	7.756	183	0.028	0.082	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
13	PDB:7wtxt	0.045	0.164	8.268	132	0.035	0.144	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
14	PDB:7a5fo3	0.055	0.281	8.813	94	0.026	0.149	7a5fo3.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75298	0.0	1090	545	1.000	1.000	RTN2_HUMAN Reticulon-2 OS=Homo sapiens OX=9606 GN=RTN2 PE=1 SV=1
2	O70622	2.51e-133	397	471	0.407	0.471	RTN2_MOUSE Reticulon-2 OS=Mus musculus OX=10090 GN=Rtn2 PE=1 SV=1
3	Q6WN19	2.66e-132	395	469	0.402	0.467	RTN2_RAT Reticulon-2 OS=Rattus norvegicus OX=10116 GN=Rtn2 PE=1 SV=1
4	Q6IFY7	1.30e-57	193	207	0.171	0.449	RTN1A_XENLA Reticulon-1-A OS=Xenopus laevis OX=8355 GN=rtn1-a PE=2 SV=1
5	Q99P72	1.20e-56	207	1162	0.174	0.082	RTN4_MOUSE Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 SV=2
6	Q9NQC3	1.99e-56	206	1192	0.180	0.082	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
7	Q9JK11	4.81e-56	205	1163	0.172	0.081	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
8	Q4FZ76	7.58e-55	189	321	0.163	0.277	RTN2_XENLA Reticulon-2 OS=Xenopus laevis OX=8355 GN=rtn2 PE=2 SV=1
9	Q4G5W2	8.13e-55	189	322	0.165	0.280	Q4G5W2_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
10	F1QT89	2.30e-54	184	196	0.172	0.480	F1QT89_DANRE Reticulon OS=Danio rerio OX=7955 GN=Nogo-B PE=1 SV=1
11	Q4G5V9	3.75e-54	184	212	0.167	0.429	Q4G5V9_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
12	Q64548	8.57e-54	196	777	0.182	0.127	RTN1_RAT Reticulon-1 OS=Rattus norvegicus OX=10116 GN=Rtn1 PE=1 SV=1
13	Q16799	1.61e-53	196	776	0.172	0.121	RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
14	Q2NKQ5	1.62e-53	195	702	0.172	0.134	Q2NKQ5_HUMAN Reticulon OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
15	Q8K0T0	1.89e-53	196	780	0.171	0.119	RTN1_MOUSE Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1
16	Q9ES97	2.01e-50	188	964	0.154	0.087	RTN3_MOUSE Reticulon-3 OS=Mus musculus OX=10090 GN=Rtn3 PE=1 SV=2
17	Q6RJR6	2.76e-50	188	940	0.154	0.089	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
18	O95197	1.06e-49	186	1032	0.150	0.079	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
19	Q9VMW4	2.43e-47	166	222	0.134	0.329	Q9VMW4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
20	Q7KTP4	6.72e-47	165	234	0.139	0.325	Q7KTP4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02453 Reticulon	2.4e-37	139.8	Reticulon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368959	0.837	Receptor expression-enhancing protein 5
2	9606.ENSP00000480893	0.833	Spastin
3	9606.ENSP00000438346	0.820	Receptor expression-enhancing protein 1
4	9606.ENSP00000351155	0.772	Atlastin-1
5	9606.ENSP00000367590	0.748	Receptor expression-enhancing protein 2
6	9606.ENSP00000245919	0.689	Protein fosB
7	9606.ENSP00000337838	0.682	Reticulon-4
8	9606.ENSP00000384515	0.672	Beta-parvin
9	9606.ENSP00000233596	0.670	Receptor accessory protein 6
10	9606.ENSP00000357882	0.651	L-seryl-tRNA(Sec) kinase
11	9606.ENSP00000334008	0.642	Alpha-parvin
12	9606.ENSP00000332979	0.631	Beta-secretase 2
13	9606.ENSP00000357480	0.630	Dehydrodolichyl diphosphate synthase complex subunit NUS1
14	9606.ENSP00000254730	0.624	Selenocysteine-specific elongation factor
15	9606.ENSP00000422473	0.587	Transmembrane protein 33
16	9606.ENSP00000318585	0.583	Beta-secretase 1
17	9606.ENSP00000256578	0.581	AMP deaminase 2
18	9606.ENSP00000219368	0.580	Fatty acid 2-hydroxylase
19	9606.ENSP00000318016	0.570	WASH complex subunit 5
20	9606.ENSP00000358582	0.567	AP-4 complex subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.977	biological regulation
GO:0050789	0.962	regulation of biological process
GO:0009987	0.955	cellular process
GO:1902991	0.847	regulation of amyloid precursor protein catabolic process
GO:0009892	0.830	negative regulation of metabolic process
GO:0034248	0.738	regulation of amide metabolic process
GO:0010605	0.714	negative regulation of macromolecule metabolic process
GO:0051172	0.708	negative regulation of nitrogen compound metabolic process
GO:0051248	0.615	negative regulation of protein metabolic process
GO:0050794	0.554	regulation of cellular process
GO:0034249	0.474	negative regulation of amide metabolic process
GO:0008152	0.451	metabolic process
GO:0071704	0.370	organic substance metabolic process
GO:1902003	0.340	regulation of amyloid-beta formation
GO:0051179	0.323	localization
GO:0016043	0.311	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.435	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]