StarFunc result for job id O75306

User Input

>input (463 residues)
MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAH
WKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRL
LNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
MDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75306	1.000	1.000	3.888E-78	463	1.000	1.000	O75306.pdb.gz	NDUS2_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2 PE=1 SV=2
2	AFDB:Q9V4E0	0.919	0.909	7.681E-65	468	0.749	0.741	Q9V4E0.pdb.gz	Q9V4E0_DROME Complex I-49kD OS=Drosophila melanogaster OX=7227 GN=ND-49 PE=1 SV=2
3	PDB:7b93D	0.904	0.972	1.425E-63	430	0.870	0.937	7b93D.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
4	PDB:7qsnD	0.866	0.992	8.747E-59	404	0.838	0.960	7qsnD.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	AFDB:Q93873	0.855	0.821	1.564E-58	482	0.648	0.622	Q93873.pdb.gz	NDUS2_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gas-1 PE=3 SV=2
6	AFDB:Q5AH07	0.838	0.811	4.294E-54	478	0.592	0.573	Q5AH07.pdb.gz	Q5AH07_CANAL Nuc2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NUC2 PE=3 SV=1
7	AFDB:Q2F990	0.843	0.990	1.380E-51	394	0.583	0.685	Q2F990.pdb.gz	Q2F990_ORYSI NAD(P)H dehydrogenase subunit H OS=Oryza sativa subsp. indica OX=39946 GN=nad7 PE=3 SV=1
8	AFDB:Q23883	0.835	0.952	5.984E-51	406	0.531	0.606	Q23883.pdb.gz	NDUS2_DICDI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium discoideum OX=44689 GN=nad7 PE=1 SV=1
9	AFDB:Q608X9	0.829	0.655	9.474E-40	587	0.382	0.302	Q608X9.pdb.gz	NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nuoC PE=3 SV=1
10	AFDB:P9WJH5	0.813	0.854	7.967E-39	440	0.395	0.416	P9WJH5.pdb.gz	NUOD_MYCTU NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoD PE=1 SV=1
11	AFDB:P0C335	0.802	0.942	1.279E-38	393	0.354	0.417	P0C335.pdb.gz	NDHH_ORYSA NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa OX=4530 GN=ndhH PE=3 SV=1
12	AFDB:P33599	0.821	0.639	1.646E-37	596	0.350	0.272	P33599.pdb.gz	NUOCD_ECOLI NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12) OX=83333 GN=nuoC PE=1 SV=3
13	PDB:7awtD	0.818	0.645	4.461E-33	589	0.354	0.278	7awtD.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
14	PDB:7wfgH	0.738	0.954	3.011E-28	356	0.320	0.416	7wfgH.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
15	PDB:6rtpB	0.574	0.550	1.002E-8	484	0.143	0.136	6rtpB.pdb.gz	A Hydrophilic Channel Is Involved in Oxidative Inactivation of a [NiFeSe] Hydrogenase
16	PDB:6ehqL	0.505	0.432	7.310E-8	551	0.149	0.125	6ehqL.pdb.gz	The structure of hydrogenase-2 fromEscherichia coli: implications for H2-driven proton pumping.
17	PDB:4iubL	0.534	0.420	1.634E-7	602	0.140	0.108	4iubL.pdb.gz	Reversible [4Fe-3S] cluster morphing in an O2-tolerant [NiFe] hydrogenase.
18	PDB:5a4fL	0.578	0.468	2.502E-7	581	0.130	0.103	5a4fL.pdb.gz	Mechanism of hydrogen activation by [NiFe] hydrogenases.
19	PDB:6xz4A	0.086	0.119	4.419E-1	304	0.060	0.092	6xz4A.pdb.gz
20	PDB:4cejA	0.090	0.043	1.585	1177	0.052	0.020	4cejA.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75306	0.0	965	463	1.000	1.000	NDUS2_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2 PE=1 SV=2
2	P17694	0.0	938	463	0.950	0.950	NDUS2_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS2 PE=1 SV=2
3	Q23883	0.0	520	406	0.531	0.606	NDUS2_DICDI NADH-ubiquinone oxidoreductase 49 kDa subunit OS=Dictyostelium discoideum OX=44689 GN=nad7 PE=1 SV=1
4	Q2F990	0.0	575	394	0.583	0.685	Q2F990_ORYSI NAD(P)H dehydrogenase subunit H OS=Oryza sativa subsp. indica OX=39946 GN=nad7 PE=3 SV=1
5	Q5AH07	0.0	588	478	0.585	0.567	Q5AH07_CANAL Nuc2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NUC2 PE=3 SV=1
6	Q641Y2	0.0	916	463	0.924	0.924	NDUS2_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs2 PE=1 SV=1
7	Q8HCQ3	0.0	575	394	0.583	0.685	Q8HCQ3_ORYSJ NAD(P)H dehydrogenase subunit H OS=Oryza sativa subsp. japonica OX=39947 GN=nad7 PE=3 SV=1
8	Q91WD5	0.0	909	463	0.924	0.924	NDUS2_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs2 PE=1 SV=1
9	Q93873	0.0	619	482	0.616	0.591	NDUS2_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gas-1 PE=3 SV=2
10	Q9V4E0	0.0	732	468	0.739	0.731	Q9V4E0_DROME Complex I-49kD OS=Drosophila melanogaster OX=7227 GN=ND-49 PE=1 SV=2
11	P9WJH5	3.66e-114	344	440	0.378	0.398	NUOD_MYCTU NADH-quinone oxidoreductase subunit D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoD PE=1 SV=1
12	Q608X9	5.18e-111	341	587	0.374	0.295	NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nuoC PE=3 SV=1
13	P0C335	7.19e-102	311	393	0.354	0.417	NDHH_ORYSA NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa OX=4530 GN=ndhH PE=3 SV=1
14	P0C336	7.19e-102	311	393	0.354	0.417	NDHH_ORYSI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhH PE=3 SV=1
15	P0C337	7.19e-102	311	393	0.354	0.417	NDHH_ORYSJ NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhH PE=3 SV=1
16	Q6ENA1	7.19e-102	311	393	0.354	0.417	NDHH_ORYNI NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Oryza nivara OX=4536 GN=ndhH PE=3 SV=1
17	P33599	5.18e-101	316	596	0.337	0.262	NUOCD_ECOLI NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12) OX=83333 GN=nuoC PE=1 SV=3
18	P56753	3.94e-97	299	393	0.333	0.392	NDHH_ARATH NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhH PE=1 SV=1
19	C5MRJ2	4.01e-46	161	216	0.186	0.398	C5MRJ2_ORYSA NAD(P)H dehydrogenase subunit H (Fragment) OS=Oryza sativa OX=4530 GN=ndhH PE=3 SV=1
20	C5MRJ4	4.01e-46	161	216	0.186	0.398	C5MRJ4_ORYSI NAD(P)H dehydrogenase subunit H (Fragment) OS=Oryza sativa subsp. indica OX=39946 GN=ndhH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00346 Complex1_49kDa	3.6e-124	424.8	Respiratory-chain NADH dehydrogenase, 49 Kd subunit
2	PF00374 NiFeSe_Hases	2.8e+02	11.8	Nickel-dependent hydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356972

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
12	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
13	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
14	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
15	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
16	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
17	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
18	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
19	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
20	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019826	1.000	oxygen sensor activity
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity
GO:0044389	0.547	ubiquitin-like protein ligase binding
GO:0031625	0.528	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.993	cellular metabolic process
GO:0050896	0.976	response to stimulus
GO:0009060	0.967	aerobic respiration
GO:0006119	0.952	oxidative phosphorylation
GO:0022904	0.918	respiratory electron transport chain
GO:0042775	0.895	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.894	aerobic electron transport chain
GO:0006120	0.884	mitochondrial electron transport, NADH to ubiquinone
GO:0070482	0.855	response to oxygen levels
GO:0042221	0.793	response to chemical
GO:0071453	0.583	cellular response to oxygen levels
GO:0071840	0.460	cellular component organization or biogenesis
GO:0006950	0.435	response to stress
GO:0007005	0.422	mitochondrion organization
GO:0006979	0.420	response to oxidative stress
GO:0065003	0.369	protein-containing complex assembly
GO:0033108	0.341	mitochondrial respiratory chain complex assembly
GO:0010257	0.333	NADH dehydrogenase complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0032991	0.995	protein-containing complex
GO:0005743	0.993	mitochondrial inner membrane
GO:0098798	0.974	mitochondrial protein-containing complex
GO:1902494	0.954	catalytic complex
GO:0098800	0.952	inner mitochondrial membrane protein complex
GO:0005747	0.942	mitochondrial respiratory chain complex I
GO:0043233	0.776	organelle lumen
GO:0070013	0.743	intracellular organelle lumen
GO:0005759	0.610	mitochondrial matrix
GO:0005634	0.433	nucleus
GO:0031981	0.324	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]