StarFunc result for job id O75311

User Input

>input (464 residues)
MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75311	1.000	1.000	9.015E-85	464	1.000	1.000	O75311.pdb.gz	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
2	AFDB:P07727	0.820	0.832	6.628E-74	457	0.802	0.814	P07727.pdb.gz	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
3	AFDB:B3DJL8	0.812	0.837	1.592E-70	450	0.810	0.836	B3DJL8.pdb.gz
4	AFDB:P22771	0.824	0.845	1.556E-69	452	0.746	0.765	P22771.pdb.gz	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
5	AFDB:O93430	0.805	0.840	1.944E-69	444	0.778	0.813	O93430.pdb.gz	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
6	AFDB:F1Q832	0.822	0.831	5.003E-69	459	0.731	0.739	F1Q832.pdb.gz
7	AFDB:Q61603	0.827	0.841	9.222E-69	456	0.731	0.743	Q61603.pdb.gz	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
8	AFDB:Q5U3C8	0.824	0.720	1.919E-66	532	0.716	0.624	Q5U3C8.pdb.gz	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
9	AFDB:A0A2R8QMY9	0.803	0.810	8.610E-66	460	0.705	0.711	A0A2R8QMY9.pdb.gz
10	AFDB:F1R8P4	0.815	0.842	9.404E-65	449	0.728	0.753	F1R8P4.pdb.gz	GLRA2_DANRE Glycine receptor subunit alpha-2 OS=Danio rerio OX=7955 GN=glra2 PE=3 SV=2
11	PDB:6i53B	0.675	0.923	1.905E-39	338	0.332	0.456	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:7kuyE	0.649	0.877	9.039E-39	338	0.418	0.574	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
13	PDB:6i53A	0.674	0.892	4.288E-38	349	0.312	0.415	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:4hfcA	0.600	0.878	2.356E-24	311	0.151	0.225	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.490	0.711	5.115E-19	311	0.149	0.222	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.534	0.833	2.395E-15	288	0.142	0.229	6zgdA.pdb.gz
17	PDB:4afhA	0.366	0.746	3.193E-13	213	0.069	0.150	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:2w8gC	0.356	0.714	4.217E-13	217	0.065	0.138	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
19	PDB:4aq5E	0.579	0.710	1.026E-12	370	0.140	0.176	4aq5E.pdb.gz
20	PDB:4wz9B	0.097	0.065	4.286E-4	887	0.043	0.023	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D1KZ66	0.0	681	448	0.705	0.730	D1KZ66_DANRE Glycine receptor alpha 2 subunit OS=Danio rerio OX=7955 GN=glra2 PE=2 SV=1
2	F1R8P4	0.0	682	449	0.707	0.731	GLRA2_DANRE Glycine receptor subunit alpha-2 OS=Danio rerio OX=7955 GN=glra2 PE=3 SV=2
3	F1RDZ6	0.0	710	457	0.763	0.775	F1RDZ6_DANRE Glycine receptor subunit alpha-4 isoform X1 OS=Danio rerio OX=7955 GN=[a]Z2 PE=3 SV=1
4	O75311	0.0	971	464	1.000	1.000	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
5	O93430	0.0	744	444	0.784	0.820	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
6	P07727	0.0	749	457	0.802	0.814	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
7	P22771	0.0	720	452	0.763	0.783	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
8	P23415	0.0	753	457	0.800	0.812	GLRA1_HUMAN Glycine receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GLRA1 PE=1 SV=2
9	P23416	0.0	724	452	0.765	0.785	GLRA2_HUMAN Glycine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GLRA2 PE=1 SV=1
10	P24524	0.0	953	464	0.981	0.981	GLRA3_RAT Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1
11	Q5U3C8	0.0	677	532	0.726	0.633	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
12	Q61603	0.0	716	456	0.759	0.772	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
13	Q64018	0.0	748	457	0.800	0.812	GLRA1_MOUSE Glycine receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Glra1 PE=1 SV=2
14	Q7TNC8	0.0	722	452	0.765	0.785	GLRA2_MOUSE Glycine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Glra2 PE=1 SV=1
15	Q90W14	0.0	762	450	0.817	0.842	Q90W14_DANRE Glycine receptor alphaZ3 subunit OS=Danio rerio OX=7955 GN=glyRalpha3 PE=2 SV=1
16	Q91XP5	0.0	961	464	0.989	0.989	GLRA3_MOUSE Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2
17	Q9DES9	0.0	701	456	0.744	0.757	Q9DES9_DANRE Glycine receptor alphaZ2 subunit OS=Danio rerio OX=7955 GN=glyR alpha PE=2 SV=1
18	Q9UPF3	5.57e-162	458	219	0.472	1.000	Q9UPF3_HUMAN Glycine receptor alpha 3 subunit (Fragment) OS=Homo sapiens OX=9606 GN=GLRA3 PE=2 SV=1
19	P48167	3.68e-128	382	497	0.472	0.441	GLRB_HUMAN Glycine receptor subunit beta OS=Homo sapiens OX=9606 GN=GLRB PE=1 SV=1
20	Q6DC22	4.69e-128	382	494	0.470	0.441	Q6DC22_DANRE Glycine receptor beta subunit 2 OS=Danio rerio OX=7955 GN=glrb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	6.8e-49	177.8	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	1.1e-34	132.2	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005556385.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005561574.1	0.841	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
2	9541.XP_005594292.1	0.748	Transcription elongation factor A protein-like 3
3	9541.XP_005594288.1	0.681	Transcription elongation factor A like 1
4	9541.XP_005593823.1	0.665	Uncharacterized protein
5	9541.XP_005594312.1	0.649	Rab-9-like protein
6	9541.XP_005553325.1	0.603	High mobility group protein HMG-I/HMG-Y isoform X1
7	9541.XP_005556213.1	0.587	Uncharacterized protein
8	9541.XP_005587101.1	0.559	Interactor with CDK3 1
9	9541.XP_005563795.1	0.558	Uncharacterized protein
10	9541.XP_005575834.1	0.544	Protein FAM161A isoform X1
11	9541.XP_005556374.1	0.536	Centrosomal protein of 44 kDa isoform X1
12	9541.XP_005594297.1	0.528	Glycine receptor subunit alpha-4 isoform X1
13	9541.XP_005552048.1	0.527	G-protein coupled receptor 126 isoform X1
14	9541.XP_005593064.1	0.526	Belongs to the ligand-gated ion channel (TC 1.A.9) family.
15	9541.XP_005549809.1	0.511	POU domain, class 6, transcription factor 2 isoform X1
16	9541.XP_005549935.1	0.509	glycyl-tRNA synthetase
17	9541.XP_005554896.1	0.503	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016934	0.997	extracellularly glycine-gated chloride channel activity
GO:0038023	0.968	signaling receptor activity
GO:0022824	0.923	transmitter-gated monoatomic ion channel activity
GO:0005488	0.909	binding
GO:0005515	0.820	protein binding
GO:0004888	0.636	transmembrane signaling receptor activity
GO:0098960	0.408	postsynaptic neurotransmitter receptor activity
GO:0099529	0.333	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0015698	0.986	inorganic anion transport
GO:0006820	0.986	monoatomic anion transport
GO:0009987	0.980	cellular process
GO:1901698	0.978	response to nitrogen compound
GO:0006821	0.976	chloride transport
GO:0050789	0.968	regulation of biological process
GO:0043200	0.967	response to amino acid
GO:0032501	0.951	multicellular organismal process
GO:0050794	0.944	regulation of cellular process
GO:1902476	0.846	chloride transmembrane transport
GO:0003008	0.838	system process
GO:0050905	0.778	neuromuscular process
GO:0048856	0.773	anatomical structure development
GO:0051716	0.767	cellular response to stimulus
GO:0007275	0.746	multicellular organism development
GO:0001964	0.734	startle response
GO:0048731	0.655	system development
GO:0007399	0.620	nervous system development
GO:0043524	0.611	negative regulation of neuron apoptotic process
GO:0007154	0.532	cell communication
GO:0045664	0.502	regulation of neuron differentiation
GO:0023052	0.490	signaling
GO:0007165	0.399	signal transduction
GO:0007610	0.385	behavior
GO:0007417	0.381	central nervous system development
GO:0023051	0.345	regulation of signaling
GO:0071840	0.306	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.987	organelle
GO:0030054	0.783	cell junction
GO:0045202	0.743	synapse
GO:0005622	0.688	intracellular anatomical structure
GO:0043227	0.636	membrane-bounded organelle
GO:0043229	0.615	intracellular organelle
GO:0098690	0.609	glycinergic synapse
GO:0098590	0.519	plasma membrane region
GO:0032991	0.473	protein-containing complex
GO:0045211	0.325	postsynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]