StarFunc result for job id O75312

User Input

>input (459 residues)
MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT
RLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKT
DSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIV
KLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPA
EKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKS
GGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKD
IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75312	1.000	1.000	4.049E-87	459	1.000	1.000	O75312.pdb.gz	ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1
2	AFDB:Q9W379	0.464	0.466	5.724E-56	457	0.481	0.484	Q9W379.pdb.gz	ZPR1_DROME Zinc finger protein ZPR1 OS=Drosophila melanogaster OX=7227 GN=Zpr1 PE=2 SV=1
3	AFDB:O16999	0.445	0.448	4.280E-52	455	0.381	0.385	O16999.pdb.gz	ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans OX=6239 GN=W03F9.1 PE=3 SV=2
4	AFDB:P53303	0.429	0.406	2.410E-49	486	0.442	0.418	P53303.pdb.gz	ZPR1_YEAST Zinc finger chaperone ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZPR1 PE=1 SV=1
5	AFDB:O13724	0.740	0.740	6.925E-49	459	0.410	0.410	O13724.pdb.gz	ZPR1_SCHPO Zinc finger chaperone zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zpr1 PE=3 SV=1
6	AFDB:A0A178UA90	0.408	0.381	1.262E-47	493	0.392	0.365	A0A178UA90.pdb.gz	A0A178UA90_ARATH Zinc finger ZPR1-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g22480 PE=1 SV=1
7	AFDB:Q57ZU8	0.417	0.407	1.863E-46	471	0.381	0.372	Q57ZU8.pdb.gz	Q57ZU8_TRYB2 Zinc-finger protein ZPR1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.690 PE=3 SV=1
8	PDB:5w0pC	0.099	0.062	4.903E-3	850	0.063	0.034	5w0pC.pdb.gz
9	PDB:5tv1A	0.079	0.099	2.039E-2	337	0.063	0.086	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
10	AFDB:Q6FNG1	0.088	0.054	5.188E-2	832	0.072	0.040	Q6FNG1.pdb.gz	AWP2_CANGA Adhesin AWP2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP2 PE=1 SV=1
11	AFDB:P28320	0.088	0.130	7.121E-2	278	0.046	0.076	P28320.pdb.gz	YJU2_YEAST Splicing factor YJU2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJU2 PE=1 SV=1
12	PDB:6l4cC	0.089	0.110	8.477E-2	353	0.061	0.079	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
13	AFDB:O35295	0.089	0.120	8.794E-2	324	0.081	0.114	O35295.pdb.gz	PURB_MOUSE Transcriptional activator protein Pur-beta OS=Mus musculus OX=10090 GN=Purb PE=1 SV=3
14	PDB:1tg7A	0.117	0.063	8.936E-2	971	0.083	0.039	1tg7A.pdb.gz	Crystal Structures of beta-Galactosidase from Penicillium sp. and its Complex with Galactose
15	PDB:5fj9I	0.081	0.297	1.515E-1	92	0.048	0.239	5fj9I.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
16	PDB:3b07B	0.075	0.118	1.597E-1	270	0.050	0.085	3b07B.pdb.gz
17	PDB:1fxzA	0.083	0.095	1.775E-1	371	0.063	0.078	1fxzA.pdb.gz
18	PDB:4c2mI	0.079	0.236	1.871E-1	124	0.028	0.105	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
19	PDB:5yzgY	0.088	0.157	1.972E-1	204	0.046	0.103	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:6drvA	0.100	0.054	2.707E-1	1024	0.044	0.020	6drvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75312	0.0	951	459	1.000	1.000	ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1
2	Q62384	0.0	822	459	0.904	0.904	ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus OX=10090 GN=Zpr1 PE=1 SV=1
3	Q9W379	9.72e-148	431	457	0.477	0.479	ZPR1_DROME Zinc finger protein ZPR1 OS=Drosophila melanogaster OX=7227 GN=Zpr1 PE=2 SV=1
4	P53303	1.25e-127	380	486	0.455	0.430	ZPR1_YEAST Zinc finger chaperone ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZPR1 PE=1 SV=1
5	O16999	3.05e-121	363	455	0.383	0.387	ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans OX=6239 GN=W03F9.1 PE=3 SV=2
6	O13724	1.42e-118	356	459	0.416	0.416	ZPR1_SCHPO Zinc finger chaperone zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zpr1 PE=3 SV=1
7	A0A178UA90	1.48e-112	342	493	0.401	0.373	A0A178UA90_ARATH Zinc finger ZPR1-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g22480 PE=1 SV=1
8	Q57ZU8	1.63e-102	315	471	0.373	0.363	Q57ZU8_TRYB2 Zinc-finger protein ZPR1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.690 PE=3 SV=1
9	Q24478	1.6	33.9	1096	0.048	0.020	CP190_DROME Centrosome-associated zinc finger protein Cp190 OS=Drosophila melanogaster OX=7227 GN=Cp190 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14353 CpXC	2.9e+02	12.9	CpXC protein
2	PF06170 DUF983	7.4e+02	11.9	Protein of unknown function (DUF983)
3	PF05129 Elf1	6.4e+02	11.8	Transcription elongation factor Elf1 like
4	PF01155 HypA	4.3e+02	12.3	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF13248 zf-ribbon_3	76	14.1	zinc-ribbon domain
6	PF03367 zf-ZPR1	3.4e-110	376.6	ZPR1 zinc-finger domain
7	PF07191 zinc-ribbons_6	3.1e+02	12.7	zinc-ribbons
8	PF09723 Zn-ribbon_8	39	15.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000227322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339063	0.956	Elongation factor 1-alpha 1
2	9606.ENSP00000275493	0.881	Epidermal growth factor receptor
3	9606.ENSP00000368565	0.867	DnaJ homolog subfamily C member 2
4	9606.ENSP00000454852	0.820	Snurportin-1
5	9606.ENSP00000260210	0.815	BUD13 homolog
6	9606.ENSP00000445002	0.799	Apolipoprotein A-V
7	9606.ENSP00000352162	0.794	ELAV-like protein 3
8	9606.ENSP00000261015	0.752	Ribosome biogenesis protein WDR12
9	9606.ENSP00000351646	0.709	Stress-induced-phosphoprotein 1
10	9606.ENSP00000357292	0.698	Ubiquilin-4
11	9606.ENSP00000428209	0.680	Ubiquitin-conjugating enzyme E2 variant 2
12	9606.ENSP00000248846	0.668	Gamma-tubulin complex component 6
13	9606.ENSP00000368970	0.659	Ubiquitin-fold modifier 1
14	9606.ENSP00000350937	0.658	Testin
15	9606.ENSP00000217182	0.653	Elongation factor 1-alpha 2
16	9606.ENSP00000358635	0.646	Heterogeneous nuclear ribonucleoprotein Q
17	9606.ENSP00000356982	0.645	Ubiquitin-fold modifier-conjugating enzyme 1
18	9606.ENSP00000381717	0.644	Ubiquitin-conjugating enzyme E2 D2
19	9606.ENSP00000296271	0.641	Rhodopsin
20	9606.ENSP00000270861	0.639	Serine/threonine-protein kinase PLK4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031369	0.999	translation initiation factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0071704	0.976	organic substance metabolic process
GO:0044237	0.969	cellular metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0044238	0.956	primary metabolic process
GO:0043170	0.950	macromolecule metabolic process
GO:0032502	0.942	developmental process
GO:0034641	0.932	cellular nitrogen compound metabolic process
GO:1901360	0.929	organic cyclic compound metabolic process
GO:0046483	0.929	heterocycle metabolic process
GO:0006725	0.928	cellular aromatic compound metabolic process
GO:0048522	0.924	positive regulation of cellular process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0071840	0.894	cellular component organization or biogenesis
GO:0016043	0.879	cellular component organization
GO:0032501	0.858	multicellular organismal process
GO:0006139	0.854	nucleobase-containing compound metabolic process
GO:0050896	0.798	response to stimulus
GO:0090304	0.709	nucleic acid metabolic process
GO:0031323	0.684	regulation of cellular metabolic process
GO:0010468	0.682	regulation of gene expression
GO:0080090	0.660	regulation of primary metabolic process
GO:0051171	0.644	regulation of nitrogen compound metabolic process
GO:0048856	0.636	anatomical structure development
GO:0051716	0.611	cellular response to stimulus
GO:0009893	0.576	positive regulation of metabolic process
GO:0010604	0.546	positive regulation of macromolecule metabolic process
GO:0007049	0.521	cell cycle
GO:0007275	0.499	multicellular organism development
GO:0060341	0.497	regulation of cellular localization
GO:0032880	0.474	regulation of protein localization
GO:0051049	0.447	regulation of transport
GO:0006996	0.435	organelle organization
GO:0022402	0.428	cell cycle process
GO:0044260	0.424	cellular macromolecule metabolic process
GO:0048731	0.409	system development
GO:0009889	0.407	regulation of biosynthetic process
GO:0019219	0.404	regulation of nucleobase-containing compound metabolic process
GO:0042307	0.402	positive regulation of protein import into nucleus
GO:0031326	0.386	regulation of cellular biosynthetic process
GO:0022008	0.365	neurogenesis
GO:0048699	0.356	generation of neurons
GO:0030182	0.343	neuron differentiation
GO:0010628	0.318	positive regulation of gene expression
GO:0048666	0.315	neuron development
GO:0006997	0.313	nucleus organization
GO:0030030	0.310	cell projection organization
GO:0061564	0.302	axon development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0043228	0.983	non-membrane-bounded organelle
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0016604	0.956	nuclear body
GO:0015030	0.943	Cajal body
GO:0005730	0.754	nucleolus
GO:0005829	0.686	cytosol
GO:0032991	0.584	protein-containing complex
GO:0097504	0.524	Gemini of coiled bodies

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]