StarFunc result for job id O75323

User Input

>input (286 residues)
MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDA
HSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGE
QDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVP
RSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYR
DLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75323	1.000	1.000	5.168E-60	286	1.000	1.000	O75323.pdb.gz	NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1
2	AFDB:O55125	0.843	0.849	1.480E-47	284	0.696	0.701	O55125.pdb.gz	NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus OX=10090 GN=Nipsnap1 PE=1 SV=1
3	AFDB:Q9UFN0	0.694	0.798	4.110E-19	247	0.185	0.215	Q9UFN0.pdb.gz	NPS3A_HUMAN Protein NipSnap homolog 3A OS=Homo sapiens OX=9606 GN=NIPSNAP3A PE=1 SV=2
4	AFDB:B1AWZ3	0.698	0.802	5.541E-19	247	0.171	0.198	B1AWZ3.pdb.gz	B1AWZ3_MOUSE Nipsnap homolog 3A OS=Mus musculus OX=10090 GN=Nipsnap3a PE=1 SV=1
5	AFDB:Q9CQE1	0.689	0.792	2.953E-18	247	0.178	0.206	Q9CQE1.pdb.gz	NPS3B_MOUSE Protein NipSnap homolog 3B OS=Mus musculus OX=10090 GN=Nipsnap3b PE=1 SV=1
6	AFDB:Q9D9L2	0.535	0.664	4.046E-11	227	0.129	0.163	Q9D9L2.pdb.gz	Q9D9L2_MOUSE NIPSNAP domain-containing protein OS=Mus musculus OX=10090 GN=Nipsnap3a PE=2 SV=1
7	AFDB:Q9SIP1	0.505	0.541	1.369E-7	263	0.101	0.110	Q9SIP1.pdb.gz	UP3_ARATH Stress-response A/B barrel domain-containing protein UP3 OS=Arabidopsis thaliana OX=3702 GN=UP3 PE=1 SV=1
8	AFDB:P9WLA3	0.519	0.611	2.805E-7	236	0.091	0.110	P9WLA3.pdb.gz	Y2558_MYCTU Uncharacterized protein Rv2558 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2558 PE=1 SV=1
9	AFDB:O07243	0.382	0.490	3.782E-7	204	0.080	0.113	O07243.pdb.gz	O07243_MYCTU Possible muconolactone isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0316 PE=1 SV=1
10	AFDB:Q9SYD8	0.470	0.609	4.525E-7	210	0.066	0.090	Q9SYD8.pdb.gz	DABB1_ARATH Stress-response A/B barrel domain-containing protein DABB1 OS=Arabidopsis thaliana OX=3702 GN=DABB1 PE=1 SV=1
11	PDB:3vcdA	0.234	0.321	7.461E-6	184	0.066	0.103	3vcdA.pdb.gz
12	PDB:3q08A	0.445	0.509	4.221E-5	241	0.084	0.100	3q08A.pdb.gz	Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase.
13	PDB:6vz8F	0.182	0.272	1.002E-3	159	0.077	0.138	6vz8F.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
14	PDB:3kg0B	0.265	0.653	1.199E-3	98	0.035	0.102	3kg0B.pdb.gz
15	PDB:5it0A	0.196	0.150	2.313E-3	396	0.049	0.035	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
16	PDB:5gt2A	0.421	0.410	2.456E-3	296	0.091	0.088	5gt2A.pdb.gz	Crystal structure and biochemical features of dye-decolorizing peroxidase YfeX from Escherichia coli O157 Asp(143) and Arg(232) play divergent roles toward different substrates
17	PDB:6wo1B	0.186	0.239	2.456E-3	197	0.052	0.076	6wo1B.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
18	PDB:2f1fA	0.177	0.252	2.767E-3	163	0.056	0.098	2f1fA.pdb.gz
19	PDB:7o9jB	0.425	0.403	2.767E-3	307	0.094	0.088	7o9jB.pdb.gz	Structural and Biochemical Characterization of a Dye-Decolorizing Peroxidase from Dictyostelium discoideum .
20	PDB:4dnsA	0.196	0.128	3.311E-3	486	0.070	0.041	4dnsA.pdb.gz	Various cross-reactivity of the grass pollen group 4 allergens: crystallographic study of the Bermuda grass isoallergen Cyn d 4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55126	0.0	533	281	0.902	0.918	NIPS2_MOUSE Protein NipSnap homolog 2 OS=Mus musculus OX=10090 GN=Nipsnap2 PE=1 SV=1
2	O75323	0.0	597	286	1.000	1.000	NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1
3	O55125	7.07e-149	420	284	0.664	0.669	NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus OX=10090 GN=Nipsnap1 PE=1 SV=1
4	Q9BPW8	1.10e-145	412	284	0.657	0.662	NIPS1_HUMAN Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1
5	Q9UFN0	1.12e-09	59.7	247	0.171	0.198	NPS3A_HUMAN Protein NipSnap homolog 3A OS=Homo sapiens OX=9606 GN=NIPSNAP3A PE=1 SV=2
6	Q9CQE1	4.72e-08	55.1	247	0.147	0.170	NPS3B_MOUSE Protein NipSnap homolog 3B OS=Mus musculus OX=10090 GN=Nipsnap3b PE=1 SV=1
7	G3X8S9	2.25e-06	50.1	245	0.171	0.200	G3X8S9_MOUSE Nipsnap homolog 3A OS=Mus musculus OX=10090 GN=Nipsnap3a PE=1 SV=1
8	B1AWZ3	2.82e-06	49.7	247	0.175	0.202	B1AWZ3_MOUSE Nipsnap homolog 3A OS=Mus musculus OX=10090 GN=Nipsnap3a PE=1 SV=1
9	Q9D9L2	0.005	39.7	227	0.094	0.119	Q9D9L2_MOUSE NIPSNAP domain-containing protein OS=Mus musculus OX=10090 GN=Nipsnap3a PE=2 SV=1
10	Q8NEM2	3.4	31.6	672	0.056	0.024	SHCBP_HUMAN SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3
11	Q5XWT8	3.9	30.8	208	0.049	0.067	Q5XWT8_DANRE Ras-dva small GTPase OS=Danio rerio OX=7955 GN=im:7145881 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07978 NIPSNAP	6.7e-37	137.1	NIPSNAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392709	0.892	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
2	9606.ENSP00000358737	0.845	ATP synthase F(0) complex subunit B1, mitochondrial
3	9606.ENSP00000322450	0.822	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
4	9606.ENSP00000293350	0.751	Aldehyde dehydrogenase 16 family member A1
5	9606.ENSP00000274353	0.721	Betaine--homocysteine S-methyltransferase 1
6	9606.ENSP00000418428	0.704	Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
7	9606.ENSP00000265333	0.701	Voltage-dependent anion-selective channel protein 1
8	9606.ENSP00000343526	0.699	Ubiquitin carboxyl-terminal hydrolase 1
9	9606.ENSP00000216121	0.688	Nipsnap homolog 1
10	9606.ENSP00000311665	0.684	Proteasomal ATPase-associated factor 1
11	9606.ENSP00000320935	0.677	Solute carrier family 2, facilitated glucose transporter member 4
12	9606.ENSP00000416662	0.675	Zinc finger protein 713
13	9606.ENSP00000264784	0.672	Solute carrier family 2, facilitated glucose transporter member 9
14	9606.ENSP00000300584	0.658	TBC1 domain family member 2B
15	9606.ENSP00000349291	0.657	TBC1 domain family member 9B
16	9606.ENSP00000376071	0.648	Protein FAM117B
17	9606.ENSP00000323867	0.644	5'-AMP-activated protein kinase subunit gamma-1
18	9606.ENSP00000373620	0.640	60 kDa heat shock protein, mitochondrial
19	9606.ENSP00000341938	0.631	Sulfatase-modifying factor 2
20	9606.ENSP00000361635	0.614	Voltage-dependent anion-selective channel protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.980	cellular metabolic process
GO:0065007	0.866	biological regulation
GO:0050789	0.837	regulation of biological process
GO:0071840	0.819	cellular component organization or biogenesis
GO:0016043	0.806	cellular component organization
GO:0007005	0.792	mitochondrion organization
GO:0006091	0.776	generation of precursor metabolites and energy
GO:0050794	0.727	regulation of cellular process
GO:0048518	0.480	positive regulation of biological process
GO:0048522	0.450	positive regulation of cellular process
GO:0015980	0.413	energy derivation by oxidation of organic compounds
GO:0009060	0.363	aerobic respiration
GO:0071704	0.330	organic substance metabolic process
GO:0006119	0.324	oxidative phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.987	membrane
GO:0031090	0.942	organelle membrane
GO:0005740	0.937	mitochondrial envelope
GO:0031966	0.929	mitochondrial membrane
GO:0098588	0.688	bounding membrane of organelle
GO:0019866	0.450	organelle inner membrane
GO:0019867	0.337	outer membrane
GO:0031968	0.333	organelle outer membrane
GO:0070013	0.331	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]