StarFunc result for job id O75326

User Input

>input (666 residues)
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSC
LDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLV
LFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKI
YYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNF
NRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPN
PRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVS
SQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKE
CPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFI
ENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLT
LGLLVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3nvqA	0.879	0.996	0.000	588	0.883	1.000	3nvqA.pdb.gz
2	AFDB:O75326	1.000	1.000	0.000	666	1.000	1.000	O75326.pdb.gz	SEM7A_HUMAN Semaphorin-7A OS=Homo sapiens OX=9606 GN=SEMA7A PE=1 SV=1
3	AFDB:Q9QUR8	0.902	0.905	0.000	664	0.890	0.893	Q9QUR8.pdb.gz	SEM7A_MOUSE Semaphorin-7A OS=Mus musculus OX=10090 GN=Sema7a PE=1 SV=1
4	AFDB:R4GJE6	0.781	0.647	2.015E-46	815	0.293	0.239	R4GJE6.pdb.gz
5	AFDB:A0A2R8Q5P4	0.766	0.681	7.343E-45	756	0.272	0.239	A0A2R8Q5P4.pdb.gz
6	AFDB:O08665	0.794	0.692	3.032E-44	772	0.270	0.233	O08665.pdb.gz	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
7	AFDB:A0A2R9YJJ7	0.764	0.686	5.568E-44	746	0.288	0.257	A0A2R9YJJ7.pdb.gz
8	AFDB:A1L5C9	0.771	0.690	5.568E-44	749	0.285	0.254	A1L5C9.pdb.gz
9	AFDB:Q13214	0.775	0.694	6.481E-44	749	0.284	0.252	Q13214.pdb.gz	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
10	AFDB:M9MM94	0.765	0.665	9.719E-44	775	0.267	0.230	M9MM94.pdb.gz
11	AFDB:Q9W686	0.755	0.655	9.719E-44	778	0.288	0.247	Q9W686.pdb.gz	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
12	PDB:6qp7A	0.681	0.727	9.057E-33	620	0.194	0.208	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvnA	0.512	0.864	8.700E-27	383	0.159	0.277	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.433	0.392	3.406E-13	747	0.155	0.138	6vxkB.pdb.gz
15	PDB:7mq8LW	0.301	0.422	4.331E-6	453	0.069	0.102	7mq8LW.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5y31B	0.348	0.434	4.556E-6	511	0.042	0.055	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
17	PDB:2vduD	0.283	0.458	5.042E-6	376	0.062	0.109	2vduD.pdb.gz
18	PDB:6kivN	0.310	0.511	5.042E-6	366	0.065	0.117	6kivN.pdb.gz	Structural basis of nucleosome recognition and modification by MLL methyltransferases.
19	PDB:7wb4c	0.317	0.550	7.187E-6	346	0.063	0.121	7wb4c.pdb.gz
20	PDB:6nd4Q	0.181	0.150	7.953E-6	862	0.108	0.084	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75326	0.0	1391	666	1.000	1.000	SEM7A_HUMAN Semaphorin-7A OS=Homo sapiens OX=9606 GN=SEMA7A PE=1 SV=1
2	Q9QUR8	0.0	1219	664	0.892	0.895	SEM7A_MOUSE Semaphorin-7A OS=Mus musculus OX=10090 GN=Sema7a PE=1 SV=1
3	Q14563	1.80e-66	234	771	0.290	0.250	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
4	O08665	3.16e-63	226	772	0.288	0.249	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
5	Q63548	3.26e-62	223	772	0.285	0.246	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
6	Q90607	3.46e-62	223	772	0.281	0.242	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1
7	F1NVZ5	3.85e-62	223	808	0.296	0.244	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
8	Q62179	1.36e-61	222	823	0.276	0.224	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
9	Q13214	1.53e-61	221	749	0.239	0.212	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
10	Q9W686	4.82e-61	219	778	0.261	0.224	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
11	Q9W7J1	1.93e-60	219	860	0.248	0.192	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1
12	Q99985	5.23e-60	216	751	0.249	0.221	SEM3C_HUMAN Semaphorin-3C OS=Homo sapiens OX=9606 GN=SEMA3C PE=2 SV=2
13	Q62181	2.16e-59	214	751	0.246	0.218	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2
14	A0A1D5PZ68	2.40e-58	212	751	0.246	0.218	A0A1D5PZ68_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=3 SV=1
15	O42236	8.10e-58	210	751	0.246	0.218	SEM3C_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=2 SV=1
16	Q9W6G6	1.18e-57	210	764	0.278	0.242	SEM3D_DANRE Semaphorin-3D OS=Danio rerio OX=7955 GN=sema3d PE=2 SV=1
17	O09126	8.23e-57	209	861	0.248	0.192	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
18	E7F6C0	1.97e-55	204	787	0.252	0.213	E7F6C0_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
19	A0A2R8Q5T8	5.35e-55	203	791	0.252	0.212	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
20	O15041	7.29e-55	202	775	0.258	0.222	SEM3E_HUMAN Semaphorin-3E OS=Homo sapiens OX=9606 GN=SEMA3E PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13895 Ig_2	0.0021	29.6	Immunoglobulin domain
2	PF13927 Ig_3	1.1	21.1	Immunoglobulin domain
3	PF01437 PSI	0.0056	28.5	Plexin repeat
4	PF01403 Sema	8e-35	131.8	Sema domain
5	PF07686 V-set	2e+02	13.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258526	0.999	Plexin-C1
2	9606.ENSP00000379350	0.992	Integrin beta-1
3	9606.ENSP00000351338	0.913	Plexin-B1
4	9606.ENSP00000442736	0.892	Plexin-B3
5	9606.ENSP00000317128	0.890	Plexin-D1
6	9606.ENSP00000377061	0.890	Plexin-A1
7	9606.ENSP00000409171	0.888	Plexin-B2
8	9606.ENSP00000352882	0.886	Plexin-A4
9	9606.ENSP00000358696	0.886	Plexin-A3
10	9606.ENSP00000282588	0.827	Integrin alpha-1
11	9606.ENSP00000265371	0.808	Neuropilin-1
12	9606.ENSP00000353582	0.738	Neuropilin-2
13	9606.ENSP00000173229	0.672	Netrin-1
14	9606.ENSP00000436552	0.658	Protein turtle homolog B
15	9606.ENSP00000464030	0.649	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
16	9606.ENSP00000478570	0.610	Vascular endothelial growth factor A
17	9606.ENSP00000296503	0.578	High mobility group protein B2
18	9606.ENSP00000332164	0.576	Slit homolog 3 protein
19	9606.ENSP00000275815	0.574	Ephrin type-A receptor 1
20	9606.ENSP00000337838	0.569	Reticulon-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0098772	0.415	molecular function regulator activity
GO:0038191	0.365	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050896	0.984	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0032501	0.977	multicellular organismal process
GO:0023052	0.975	signaling
GO:0007154	0.973	cell communication
GO:0051716	0.972	cellular response to stimulus
GO:0032502	0.971	developmental process
GO:0022603	0.964	regulation of anatomical structure morphogenesis
GO:0048584	0.953	positive regulation of response to stimulus
GO:0048522	0.946	positive regulation of cellular process
GO:0009966	0.946	regulation of signal transduction
GO:0051130	0.938	positive regulation of cellular component organization
GO:0030154	0.930	cell differentiation
GO:0031346	0.924	positive regulation of cell projection organization
GO:0009967	0.923	positive regulation of signal transduction
GO:0051240	0.922	positive regulation of multicellular organismal process
GO:0007165	0.922	signal transduction
GO:0071840	0.895	cellular component organization or biogenesis
GO:0048856	0.893	anatomical structure development
GO:0007166	0.892	cell surface receptor signaling pathway
GO:0016043	0.863	cellular component organization
GO:1902531	0.863	regulation of intracellular signal transduction
GO:0051094	0.829	positive regulation of developmental process
GO:2000026	0.817	regulation of multicellular organismal development
GO:0120035	0.803	regulation of plasma membrane bounded cell projection organization
GO:0007275	0.790	multicellular organism development
GO:0050769	0.779	positive regulation of neurogenesis
GO:0050772	0.756	positive regulation of axonogenesis
GO:0030307	0.744	positive regulation of cell growth
GO:0048731	0.716	system development
GO:0007229	0.688	integrin-mediated signaling pathway
GO:0065008	0.674	regulation of biological quality
GO:1902533	0.661	positive regulation of intracellular signal transduction
GO:0007399	0.641	nervous system development
GO:0061387	0.641	regulation of extent of cell growth
GO:0048639	0.628	positive regulation of developmental growth
GO:0030516	0.589	regulation of axon extension
GO:0045773	0.579	positive regulation of axon extension
GO:0009653	0.576	anatomical structure morphogenesis
GO:0048468	0.485	cell development
GO:0048519	0.472	negative regulation of biological process
GO:0043408	0.432	regulation of MAPK cascade
GO:0019222	0.412	regulation of metabolic process
GO:0048523	0.410	negative regulation of cellular process
GO:0060255	0.377	regulation of macromolecule metabolic process
GO:0009893	0.366	positive regulation of metabolic process
GO:0030182	0.348	neuron differentiation
GO:0010604	0.342	positive regulation of macromolecule metabolic process
GO:0048666	0.341	neuron development
GO:0043410	0.329	positive regulation of MAPK cascade
GO:0070372	0.306	regulation of ERK1 and ERK2 cascade
GO:0051171	0.301	regulation of nitrogen compound metabolic process
GO:0080090	0.300	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.708	organelle
GO:0043227	0.701	membrane-bounded organelle
GO:0043229	0.701	intracellular organelle
GO:0005737	0.680	cytoplasm
GO:0030312	0.499	external encapsulating structure
GO:0062023	0.475	collagen-containing extracellular matrix
GO:0009986	0.426	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]