StarFunc result for job id O75335

User Input

>input (1185 residues)
MCEVMPTINEGDRLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAATQSRLQD
AIHERDQLQRHLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLEC
LVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVT
TLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQELLEKQNF
ELSQARERLVTLTTTVTELEEDLGTARRDLIKSEELSSKHQRDLREALAQKEDMEERITT
LEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRK
AETLPEVEAELAQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELARTAVQVRQREKMN
EDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKNTLIQELESSQRQIEEQHHHKGRL
SEEIEKLRQEVDQLKGRGGPFVDGVHSRSHMGSAADVRFSLGTTTHAPPGVHRRYSALRE
ESAKLALPLTVTLRSPTWMRMSQGVCCNLEYHSSGTLCGSSGPLPVPEMIQEEKESTELR
AEEIETRVTSGSMEALNLKQLRKRGSIPTSLTALSLASASPPLSGRSTPKLTSRSAAQDL
DRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPRTLRLEKLGHPALSQ
EEGKSALEDQGSNPSSSNSSQDSLHKGAKRKGIKSSIGRLFGKKEKGRLIQLSRDGATGH
VLLTDSEFSMQEPMVPAKLGTQAEKDRRLKKKHQLLEDARRKGMPFAQWDGPTVVSWLEL
WVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSA
PPTSRTSSGNVWVTHEEMETLETSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQ
YRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE
ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALILQI
PTQNTQARQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSAS
AETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAFRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8QI36	0.419	0.418	0.000	1187	0.906	0.905	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
2	AFDB:O75335	1.000	1.000	0.000	1185	1.000	1.000	O75335.pdb.gz	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3
3	AFDB:Q69ZW5	0.259	0.268	0.000	1140	0.877	0.911	Q69ZW5.pdb.gz	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
4	AFDB:B2RXW8	0.341	0.327	6.500E-99	1241	0.668	0.637	B2RXW8.pdb.gz	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
5	AFDB:X1WCJ5	0.278	0.269	1.143E-84	1226	0.591	0.571	X1WCJ5.pdb.gz	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
6	AFDB:M9PC73	0.294	0.300	1.621E-68	1158	0.466	0.477	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
7	AFDB:M9PCR7	0.274	0.271	3.704E-68	1205	0.483	0.475	M9PCR7.pdb.gz	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
8	AFDB:Q21049	0.241	0.251	1.491E-60	1139	0.413	0.429	Q21049.pdb.gz	LIPA_CAEEL Liprin-alpha OS=Caenorhabditis elegans OX=6239 GN=syd-2 PE=1 SV=1
9	AFDB:E7F905	0.109	0.194	1.116E-26	614	0.291	0.562	E7F905.pdb.gz
10	AFDB:Q5SNZ0	0.088	0.064	1.727E-6	1873	0.121	0.076	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
11	PDB:7cm7A	0.068	0.106	5.577E-2	620	0.039	0.074	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
12	PDB:7anwA	0.067	0.102	1.413E-1	645	0.025	0.047	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
13	PDB:3bs5A	0.052	0.601	1.927E-1	86	0.013	0.174	3bs5A.pdb.gz
14	PDB:6wpkA	0.064	0.117	2.369E-1	547	0.046	0.101	6wpkA.pdb.gz
15	PDB:3ay5A	0.049	0.096	2.913E-1	298	0.035	0.141	3ay5A.pdb.gz
16	PDB:7zs9M	0.054	0.168	5.414E-1	310	0.024	0.090	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:1g3nC	0.046	0.128	2.184	233	0.019	0.099	1g3nC.pdb.gz
18	PDB:6ff7q	0.041	0.067	2.184	625	0.018	0.034	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6hd8B	0.048	0.175	2.421	232	0.022	0.112	6hd8B.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
20	PDB:5nx7A	0.059	0.139	3.135	308	0.031	0.120	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WPJ3	1526	892	0.682	0.906	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
2	A0A087WPM2	2067	1184	0.918	0.919	A0A087WPM2_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
3	A0A0G2K3L9	1260	1142	0.600	0.623	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
4	A0A1B0GWM2	1335	1218	0.625	0.608	A0A1B0GWM2_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
5	A0A1B0GWS0	1431	1266	0.665	0.622	A0A1B0GWS0_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
6	A0A2R8Y7R9	1421	1224	0.665	0.644	A0A2R8Y7R9_HUMAN PTPRF interacting protein alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
7	A0A8I6AK94	1483	1261	0.677	0.636	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
8	A0A8I6AM56	1490	1246	0.677	0.644	A0A8I6AM56_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
9	B2RXQ2	1432	1266	0.666	0.623	B2RXQ2_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
10	B2RXW8	1445	1241	0.666	0.636	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
11	B8QI33	1428	1267	0.666	0.623	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
12	B8QI36	2034	1187	0.893	0.891	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
13	D3ZZ81	1361	1190	0.645	0.642	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
14	F1M8A4	1373	1126	0.622	0.655	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
15	M9PC73	886	1158	0.488	0.499	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
16	M9PCD4	929	1214	0.503	0.491	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
17	M9PCR7	922	1205	0.503	0.495	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
18	O75145	1245	1194	0.603	0.598	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
19	O75334	1491	1257	0.678	0.639	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
20	O75335	2413	1185	1.000	1.000	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	2.1e-23	93.9	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	4.9e-21	85.9	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021997

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002678	0.877	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
2	61853.ENSNLEP00000004675	0.803	Regulating synaptic membrane exocytosis 2
3	61853.ENSNLEP00000016348	0.783	Protein tyrosine phosphatase, receptor type, S
4	61853.ENSNLEP00000016594	0.780	Protein tyrosine phosphatase, receptor type, F
5	61853.ENSNLEP00000006700	0.777	PTPRF interacting protein, binding protein 1 (liprin beta 1)
6	61853.ENSNLEP00000021443	0.768	Protein tyrosine phosphatase, receptor type, D
7	61853.ENSNLEP00000021240	0.745	PTPRF interacting protein, binding protein 2 (liprin beta 2)
8	61853.ENSNLEP00000006311	0.727	Lin-7 homolog A, crumbs cell polarity complex component
9	61853.ENSNLEP00000000807	0.714	Amyloid beta (A4) precursor protein-binding, family A, member 1
10	61853.ENSNLEP00000006008	0.700	Lin-7 homolog B, crumbs cell polarity complex component
11	61853.ENSNLEP00000021690	0.695	Lin-7 homolog C, crumbs cell polarity complex component
12	61853.ENSNLEP00000001314	0.693	Regulating synaptic membrane exocytosis 1
13	61853.ENSNLEP00000010561	0.641	TSPO associated protein 1
14	61853.ENSNLEP00000008829	0.639	ELKS/RAB6-interacting/CAST family member 2
15	61853.ENSNLEP00000003187	0.638	ELKS/RAB6-interacting/CAST family member 1
16	61853.ENSNLEP00000006086	0.636	Synaptotagmin I
17	61853.ENSNLEP00000005475	0.629	Unc-13 homolog B (C. elegans)
18	61853.ENSNLEP00000007190	0.618	RAB3A, member RAS oncogene family
19	61853.ENSNLEP00000000683	0.611	Uncharacterized protein
20	61853.ENSNLEP00000001647	0.611	Protein tyrosine phosphatase, receptor type, E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050789	0.957	regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0065008	0.906	regulation of biological quality
GO:0009987	0.881	cellular process
GO:0051128	0.584	regulation of cellular component organization
GO:0032501	0.554	multicellular organismal process
GO:0048856	0.546	anatomical structure development
GO:0007275	0.526	multicellular organism development
GO:0048731	0.440	system development
GO:0010646	0.374	regulation of cell communication
GO:0007399	0.373	nervous system development
GO:0023051	0.370	regulation of signaling
GO:0001505	0.320	regulation of neurotransmitter levels
GO:0051179	0.303	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098793	0.997	presynapse
GO:0005737	0.970	cytoplasm
GO:0005829	0.960	cytosol
GO:0043226	0.958	organelle
GO:0098978	0.914	glutamatergic synapse
GO:0005886	0.900	plasma membrane
GO:0012505	0.867	endomembrane system
GO:0098794	0.775	postsynapse
GO:0043231	0.733	intracellular membrane-bounded organelle
GO:0042995	0.611	cell projection
GO:0048786	0.559	presynaptic active zone
GO:0032991	0.354	protein-containing complex
GO:0043005	0.331	neuron projection
GO:0097060	0.322	synaptic membrane
GO:0036477	0.317	somatodendritic compartment
GO:0099572	0.306	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]