StarFunc result for job id O75339

User Input

>input (1184 residues)
MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAE
MVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
AAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVLTMPKTSLKAATIK
AEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLLDPSLYKHESK
LVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKEC
SCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAE
LEIPSRSFYRQNGEPYIGKVKASVTFLDPRNISTATAAQTDLNFINDEGDTFPLRTYGMF
SVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEGDFKFENQR
RNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINL
EPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPLEVNVRSRNMGGTHRQTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRV
DRTLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPAQS
PAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75339	1.000	1.000	0.000	1184	1.000	1.000	O75339.pdb.gz	CILP1_HUMAN Cartilage intermediate layer protein 1 OS=Homo sapiens OX=9606 GN=CILP PE=1 SV=4
2	AFDB:Q8IUL8	0.749	0.766	0.000	1156	0.481	0.493	Q8IUL8.pdb.gz	CILP2_HUMAN Cartilage intermediate layer protein 2 OS=Homo sapiens OX=9606 GN=CILP2 PE=2 SV=2
3	AFDB:Q9W213	0.101	0.089	7.900E-16	1395	0.091	0.077	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
4	AFDB:A0A0B5JKA2	0.086	0.094	5.375E-15	1069	0.112	0.124	A0A0B5JKA2.pdb.gz
5	AFDB:O55005	0.083	0.064	5.375E-15	1651	0.104	0.075	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
6	AFDB:A0A0G2JZA1	0.099	0.080	1.036E-14	1512	0.092	0.072	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
7	AFDB:P97798	0.078	0.065	1.631E-14	1493	0.114	0.090	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
8	AFDB:A4JYH1	0.077	0.101	2.099E-14	862	0.090	0.123	A4JYH1.pdb.gz
9	AFDB:A0A2R8QRK0	0.083	0.073	4.707E-14	1420	0.103	0.086	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	AFDB:Q96MS0	0.091	0.079	5.759E-14	1386	0.124	0.106	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
11	PDB:5oj2B	0.087	0.132	1.176E-9	692	0.070	0.120	5oj2B.pdb.gz
12	PDB:1e07A	0.083	0.131	1.948E-9	642	0.052	0.097	1e07A.pdb.gz
13	PDB:6dldD	0.074	0.288	4.231E-8	269	0.035	0.156	6dldD.pdb.gz
14	PDB:6dlfA	0.079	0.326	7.139E-7	236	0.033	0.165	6dlfA.pdb.gz
15	PDB:5a42A	0.083	0.069	9.663E-7	1597	0.084	0.063	5a42A.pdb.gz
16	PDB:7q1yA	0.062	0.060	1.016E-6	1374	0.071	0.061	7q1yA.pdb.gz
17	PDB:4aq1A	0.063	0.090	2.279E-6	721	0.068	0.112	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
18	PDB:2rcjC	0.079	0.157	2.521E-6	523	0.045	0.101	2rcjC.pdb.gz
19	PDB:4lnvA	0.074	0.069	3.774E-6	1276	0.076	0.071	4lnvA.pdb.gz
20	PDB:6h03A	0.087	0.085	5.944E-6	1223	0.072	0.070	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75339	0.0	2475	1184	1.000	1.000	CILP1_HUMAN Cartilage intermediate layer protein 1 OS=Homo sapiens OX=9606 GN=CILP PE=1 SV=4
2	Q8IUL8	0.0	1196	1156	0.484	0.496	CILP2_HUMAN Cartilage intermediate layer protein 2 OS=Homo sapiens OX=9606 GN=CILP2 PE=2 SV=2
3	P98088	7.14e-07	56.6	5654	0.030	0.006	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
4	A0A0G2K1Y4	5.39e-06	53.5	3586	0.034	0.011	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
5	Q8K1G6	5.62e-06	53.5	4782	0.029	0.007	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
6	E9Q5I3	5.67e-06	53.5	4800	0.029	0.007	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
7	A0A0G2K8X5	5.95e-06	53.5	3922	0.034	0.010	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
8	Q8N126	8.03e-06	52.0	398	0.033	0.098	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
9	Q2TBA3	1.05e-05	52.4	832	0.038	0.054	MALT1_MOUSE Mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog OS=Mus musculus OX=10090 GN=Malt1 PE=1 SV=2
10	Q9HC84	1.89e-05	52.0	5762	0.028	0.006	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
11	K7EP42	2.03e-05	47.4	119	0.024	0.235	K7EP42_HUMAN MALT1 paracaspase (Fragment) OS=Homo sapiens OX=9606 GN=MALT1 PE=1 SV=1
12	F6NRL9	2.04e-05	50.8	440	0.020	0.055	F6NRL9_DANRE Vascular cell adhesion molecule 1a OS=Danio rerio OX=7955 GN=vcam1a PE=4 SV=1
13	Q9NS62	2.17e-05	51.2	852	0.023	0.032	THSD1_HUMAN Thrombospondin type-1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THSD1 PE=1 SV=1
14	E9PWB6	2.43e-05	51.2	2751	0.027	0.012	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
15	Q99N28	2.48e-05	50.4	396	0.034	0.101	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
16	E9QAQ8	2.69e-05	51.2	3455	0.027	0.009	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
17	Q61916	3.71e-05	49.7	354	0.027	0.090	Q61916_MOUSE Mucin (Fragment) OS=Mus musculus OX=10090 GN=Muc5ac PE=2 SV=1
18	O35888	4.39e-05	50.4	1034	0.033	0.038	O35888_RAT Mucin OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
19	Q8BI06	8.66e-05	49.3	1361	0.028	0.024	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
20	Q8WZ42	9.20e-05	49.7	34350	0.026	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	0.00049	31.4	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	0.00061	31.3	Carboxypeptidase regulatory-like domain
3	PF07679 I-set	0.00088	30.6	Immunoglobulin I-set domain
4	PF00047 ig	0.22	23.0	Immunoglobulin domain
5	PF13895 Ig_2	4.3e-05	35.1	Immunoglobulin domain
6	PF13927 Ig_3	5.1e-08	44.7	Immunoglobulin domain
7	PF13330 Mucin2_WxxW	2.3e-16	71.7	Mucin-2 protein WxxW repeating region
8	PF19028 TSP1_spondin	0.071	24.8	Spondin-like TSP1 domain
9	PF00090 TSP_1	0.00015	33.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302665	0.928	Insulin-like growth factor I
2	9606.ENSP00000268035	0.906	Insulin-like growth factor 1 receptor
3	9606.ENSP00000391826	0.903	Insulin-like growth factor II
4	9606.ENSP00000364694	0.751	Asporin
5	9606.ENSP00000341640	0.727	Collagen alpha-3(IX) chain
6	9606.ENSP00000222271	0.716	Cartilage oligomeric matrix protein
7	9606.ENSP00000338967	0.675	Rho GTPase-activating protein 6
8	9606.ENSP00000399679	0.667	Proteoglycan 4
9	9606.ENSP00000365351	0.665	Integrin subunit beta like 1
10	9606.ENSP00000359114	0.652	Collagen alpha-1(XI) chain
11	9606.ENSP00000378830	0.652	Glutamine-rich protein 1
12	9606.ENSP00000361834	0.649	Collagen alpha-2(IX) chain
13	9606.ENSP00000343924	0.630	Prolargin
14	9606.ENSP00000410715	0.625	Secreted frizzled-related protein 4
15	9606.ENSP00000378058	0.615	EGF-containing fibulin-like extracellular matrix protein 1
16	9606.ENSP00000347041	0.603	Fibromodulin
17	9606.ENSP00000483552	0.602	Furin
18	9606.ENSP00000219070	0.599	72 kDa type IV collagenase
19	9606.ENSP00000387356	0.572	Aggrecan core protein
20	9606.ENSP00000355751	0.567	Thrombospondin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.390	signaling receptor binding
GO:0140096	0.342	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0090287	0.987	regulation of cellular response to growth factor stimulus
GO:0090092	0.986	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.984	negative regulation of signal transduction
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:1903844	0.956	regulation of cellular response to transforming growth factor beta stimulus
GO:0090101	0.955	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030512	0.944	negative regulation of transforming growth factor beta receptor signaling pathway
GO:1902531	0.942	regulation of intracellular signal transduction
GO:0010468	0.857	regulation of gene expression
GO:1902532	0.776	negative regulation of intracellular signal transduction
GO:0009892	0.771	negative regulation of metabolic process
GO:0009987	0.713	cellular process
GO:0010605	0.657	negative regulation of macromolecule metabolic process
GO:0010629	0.647	negative regulation of gene expression
GO:0032501	0.414	multicellular organismal process
GO:0048856	0.381	anatomical structure development
GO:0050896	0.317	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.998	extracellular matrix
GO:0070062	0.998	extracellular exosome
GO:0062023	0.983	collagen-containing extracellular matrix
GO:0043231	0.741	intracellular membrane-bounded organelle
GO:0005737	0.612	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]