StarFunc result for job id O75340

User Input

>input (191 residues)
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75340	1.000	1.000	3.833E-34	191	1.000	1.000	O75340.pdb.gz	PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
2	PDB:1hqvA	0.887	0.950	1.147E-26	178	0.921	0.989	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
3	AFDB:A8Y589	0.868	0.931	2.109E-21	178	0.607	0.652	A8Y589.pdb.gz	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
4	AFDB:Q8SYT2	0.747	0.654	8.237E-18	219	0.529	0.461	Q8SYT2.pdb.gz	Q8SYT2_DROME RE34768p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=2 SV=2
5	AFDB:Q7K2L7	0.859	0.826	3.441E-15	199	0.382	0.367	Q7K2L7.pdb.gz	Q7K2L7_DROME GH27120p OS=Drosophila melanogaster OX=7227 GN=Pef PE=1 SV=1
6	AFDB:Q9UBV8	0.811	0.554	1.471E-14	284	0.403	0.271	Q9UBV8.pdb.gz	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1
7	AFDB:Q5PQ53	0.824	0.564	4.253E-14	283	0.372	0.251	Q5PQ53.pdb.gz	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
8	AFDB:A0A087WZ38	0.319	0.475	6.289E-14	123	0.639	0.992	A0A087WZ38.pdb.gz	A0A087WZ38_HUMAN Programmed cell death 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
9	PDB:4uslA	0.724	0.792	3.773E-13	173	0.314	0.347	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
10	AFDB:Q8VC88	0.615	0.546	4.446E-13	220	0.366	0.318	Q8VC88.pdb.gz	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
11	AFDB:Q2QY10	0.682	0.471	1.700E-12	292	0.346	0.226	Q2QY10.pdb.gz	CBP_ORYSJ Calcium-binding protein CBP OS=Oryza sativa subsp. japonica OX=39947 GN=CBP PE=2 SV=1
12	AFDB:B0BNJ1	0.614	0.596	2.010E-12	198	0.361	0.348	B0BNJ1.pdb.gz	B0BNJ1_RAT LOC683667 protein OS=Rattus norvegicus OX=10116 GN=Sri PE=2 SV=1
13	PDB:1kfuL	0.579	0.196	8.330E-9	699	0.220	0.060	1kfuL.pdb.gz
14	PDB:5a2hA	0.314	0.398	3.982E-8	147	0.194	0.252	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
15	PDB:6xu4A	0.342	0.184	5.569E-8	389	0.194	0.095	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
16	PDB:1kfxL	0.592	0.211	5.889E-8	640	0.220	0.066	1kfxL.pdb.gz
17	PDB:1ggzA	0.326	0.424	8.707E-8	144	0.194	0.257	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:2f2pA	0.324	0.361	1.151E-7	169	0.188	0.213	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
19	PDB:6hr1A	0.327	0.168	1.362E-7	406	0.183	0.086	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:5d43A	0.309	0.378	2.251E-7	150	0.194	0.247	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75340	1.87e-141	393	191	1.000	1.000	PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
2	P12815	7.29e-140	389	191	0.990	0.990	PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus OX=10090 GN=Pdcd6 PE=1 SV=2
3	A8Y589	5.88e-83	245	178	0.607	0.652	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
4	Q8SYT2	4.11e-68	209	219	0.508	0.443	Q8SYT2_DROME RE34768p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=2 SV=2
5	A0A087WZ38	3.81e-52	165	123	0.435	0.675	A0A087WZ38_HUMAN Programmed cell death 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
6	Q5PQ53	2.01e-40	140	283	0.387	0.261	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
7	Q7K2L7	4.16e-40	137	199	0.356	0.342	Q7K2L7_DROME GH27120p OS=Drosophila melanogaster OX=7227 GN=Pef PE=1 SV=1
8	Q9UBV8	1.01e-39	138	284	0.387	0.261	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1
9	Q8VC88	1.76e-34	123	220	0.361	0.314	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
10	Q86W51	3.03e-33	115	55	0.288	1.000	Q86W51_HUMAN PDCD6 protein OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
11	A0A8I5ZTT7	3.82e-32	116	182	0.346	0.363	A0A8I5ZTT7_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
12	A0A8I5ZWU9	4.10e-32	115	183	0.346	0.361	A0A8I5ZWU9_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
13	A0A8I6AU02	7.84e-32	115	203	0.346	0.325	A0A8I6AU02_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
14	B0BNJ1	4.20e-31	114	198	0.298	0.288	B0BNJ1_RAT LOC683667 protein OS=Rattus norvegicus OX=10116 GN=Sri PE=2 SV=1
15	P30626	7.66e-31	113	198	0.319	0.308	SORCN_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1
16	Q6P069	1.51e-30	112	198	0.293	0.283	SORCN_MOUSE Sorcin OS=Mus musculus OX=10090 GN=Sri PE=1 SV=1
17	Q2QY10	2.66e-30	114	292	0.309	0.202	CBP_ORYSJ Calcium-binding protein CBP OS=Oryza sativa subsp. japonica OX=39947 GN=CBP PE=2 SV=1
18	H7BXD5	2.75e-30	111	198	0.288	0.278	H7BXD5_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=1
19	P05044	2.81e-30	111	198	0.309	0.298	SORCN_CRIGR Sorcin OS=Cricetulus griseus OX=10029 GN=SRI PE=1 SV=1
20	P28676	3.90e-30	112	217	0.288	0.253	GRAN_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	5.8e-20	80.4	EF hand
2	PF14788 EF-hand_10	70	14.8	EF hand
3	PF13202 EF-hand_5	3.6e-11	53.2	EF hand
4	PF13405 EF-hand_6	2.2e-17	72.3	EF-hand domain
5	PF13499 EF-hand_7	1.4e-19	81.6	EF-hand domain pair
6	PF13833 EF-hand_8	1.6e-13	61.5	EF-hand domain pair
7	PF14658 EF-hand_9	1.3	20.7	EF-hand domain
8	PF03468 XS	55	15.5	XS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378721	0.999	Protein transport protein Sec31A
2	9606.ENSP00000411825	0.998	Programmed cell death 6-interacting protein
3	9606.ENSP00000362807	0.990	Peflin
4	9606.ENSP00000251968	0.985	Tumor susceptibility gene 101 protein
5	9606.ENSP00000475750	0.983	Heme-binding protein 2
6	9606.ENSP00000398610	0.978	Annexin A11
7	9606.ENSP00000356230	0.968	Kelch-like protein 12
8	9606.ENSP00000373312	0.966	Protein SEC13 homolog
9	9606.ENSP00000264079	0.956	Mucolipin-1
10	9606.ENSP00000428564	0.943	Protein transport protein Sec24B
11	9606.ENSP00000306881	0.938	Protein transport protein Sec23A
12	9606.ENSP00000343405	0.921	Protein transport protein Sec24C
13	9606.ENSP00000381823	0.920	Protein transport protein Sec24A
14	9606.ENSP00000362339	0.919	GTP-binding protein SAR1a
15	9606.ENSP00000280551	0.908	Protein transport protein Sec24D
16	9606.ENSP00000405926	0.900	Transmembrane emp24 domain-containing protein 7
17	9606.ENSP00000264414	0.876	Cullin-3
18	9606.ENSP00000438547	0.829	Phospholipid scramblase 3
19	9606.ENSP00000262374	0.811	Chitobiosyldiphosphodolichol beta-mannosyltransferase
20	9606.ENSP00000362010	0.785	Annexin A7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048306	1.000	calcium-dependent protein binding
GO:0042803	1.000	protein homodimerization activity
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.987	cellular process
GO:0050794	0.973	regulation of cellular process
GO:0050896	0.931	response to stimulus
GO:0048518	0.905	positive regulation of biological process
GO:0048583	0.828	regulation of response to stimulus
GO:0023051	0.824	regulation of signaling
GO:0051247	0.817	positive regulation of protein metabolic process
GO:0010646	0.816	regulation of cell communication
GO:0009966	0.759	regulation of signal transduction
GO:0045862	0.733	positive regulation of proteolysis
GO:0048522	0.732	positive regulation of cellular process
GO:0051345	0.698	positive regulation of hydrolase activity
GO:2000116	0.670	regulation of cysteine-type endopeptidase activity
GO:0008219	0.654	cell death
GO:0071840	0.641	cellular component organization or biogenesis
GO:0043281	0.640	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902531	0.620	regulation of intracellular signal transduction
GO:0016043	0.582	cellular component organization
GO:0008152	0.567	metabolic process
GO:0010952	0.556	positive regulation of peptidase activity
GO:0043280	0.548	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0012501	0.541	programmed cell death
GO:0051179	0.499	localization
GO:0051234	0.493	establishment of localization
GO:0006810	0.479	transport
GO:0032502	0.466	developmental process
GO:0048519	0.466	negative regulation of biological process
GO:0051641	0.465	cellular localization
GO:0006996	0.460	organelle organization
GO:0048523	0.450	negative regulation of cellular process
GO:0006915	0.429	apoptotic process
GO:0071704	0.405	organic substance metabolic process
GO:0042221	0.387	response to chemical
GO:0016050	0.365	vesicle organization
GO:0051649	0.310	establishment of localization in cell
GO:0061024	0.305	membrane organization
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.970	organelle
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0012505	0.955	endomembrane system
GO:0005829	0.953	cytosol
GO:0016020	0.952	membrane
GO:0032991	0.935	protein-containing complex
GO:0012506	0.897	vesicle membrane
GO:0070013	0.890	intracellular organelle lumen
GO:0030659	0.890	cytoplasmic vesicle membrane
GO:0098588	0.858	bounding membrane of organelle
GO:0005576	0.806	extracellular region
GO:0070062	0.801	extracellular exosome
GO:1902494	0.795	catalytic complex
GO:0005634	0.734	nucleus
GO:0031463	0.686	Cul3-RING ubiquitin ligase complex
GO:0031981	0.663	nuclear lumen
GO:0005654	0.650	nucleoplasm
GO:0098796	0.617	membrane protein complex
GO:0005783	0.505	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]