StarFunc result for job id O75342

User Input

>input (701 residues)
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70582	0.991	0.991	0.000	701	0.860	0.860	O70582.pdb.gz	LX12B_MOUSE Arachidonate 12-lipoxygenase, 12R-type OS=Mus musculus OX=10090 GN=Alox12b PE=1 SV=1
2	AFDB:O75342	1.000	1.000	0.000	701	1.000	1.000	O75342.pdb.gz	LX12B_HUMAN Arachidonate 12-lipoxygenase, 12R-type OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1
3	AFDB:D3ZKX9	0.971	0.958	9.334E-86	711	0.553	0.546	D3ZKX9.pdb.gz	LOXE3_RAT Hydroperoxide isomerase ALOXE3 OS=Rattus norvegicus OX=10116 GN=Aloxe3 PE=1 SV=1
4	AFDB:Q9BYJ1	0.974	0.961	1.183E-84	711	0.549	0.541	Q9BYJ1.pdb.gz	LOXE3_HUMAN Hydroperoxide isomerase ALOXE3 OS=Homo sapiens OX=9606 GN=ALOXE3 PE=1 SV=1
5	AFDB:Q8K4F2	0.942	0.976	2.185E-77	677	0.485	0.502	Q8K4F2.pdb.gz	LX15B_RAT Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Rattus norvegicus OX=10116 GN=Alox15b PE=1 SV=1
6	AFDB:O35936	0.940	0.973	3.140E-77	677	0.482	0.499	O35936.pdb.gz	ALOX8_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX8 OS=Mus musculus OX=10090 GN=Alox8 PE=1 SV=1
7	AFDB:O15296	0.940	0.974	3.318E-76	676	0.486	0.504	O15296.pdb.gz	LX15B_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=3
8	PDB:4nreA	0.932	0.968	1.500E-74	675	0.481	0.499	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.
9	AFDB:A0A2R8RVT0	0.926	0.963	4.507E-68	674	0.382	0.398	A0A2R8RVT0.pdb.gz
10	AFDB:Q7T2A9	0.928	0.970	2.893E-67	670	0.398	0.416	Q7T2A9.pdb.gz	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
11	AFDB:P09917	0.925	0.962	3.314E-67	674	0.389	0.405	P09917.pdb.gz	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
12	PDB:7ttjA	0.871	0.948	1.751E-63	643	0.381	0.415	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
13	PDB:6ncfB	0.916	0.949	6.826E-63	676	0.385	0.399	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
14	PDB:3v99B	0.855	0.936	1.804E-60	639	0.374	0.410	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
15	PDB:7ttlC	0.847	0.961	8.516E-59	617	0.372	0.423	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
16	PDB:7ttjB	0.807	0.957	2.251E-56	590	0.359	0.427	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
17	PDB:2p0mA	0.883	0.934	4.915E-55	662	0.334	0.353	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
18	PDB:1ygeA	0.806	0.682	2.421E-35	839	0.234	0.195	1ygeA.pdb.gz	Crystal structure of soybean lipoxygenase L-1 at 1.4 A resolution.
19	PDB:2iukA	0.849	0.720	1.554E-34	835	0.264	0.222	2iukA.pdb.gz	Crystal Structures of Vegetative Soybean Lipoxygenase Vlx-B and Vlx-D, and Comparisons with Seed Isoforms Lox-1 and Lox-3.
20	PDB:5fnoA	0.647	0.785	1.543E-21	568	0.181	0.224	5fnoA.pdb.gz	Crystal Structure of Manganese Lipoxygenase of the Rice Blast Fungus Magnaporthe Oryzae

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IRK2	0.0	768	389	0.544	0.979	A0A3B3IRK2_HUMAN Arachidonate 12-lipoxygenase, 12R type (Fragment) OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1
2	B8A697	0.0	536	674	0.391	0.407	B8A697_DANRE Arachidonate 5-lipoxygenase OS=Danio rerio OX=7955 GN=alox5 PE=3 SV=1
3	D3ZKX9	0.0	816	711	0.552	0.544	LOXE3_RAT Hydroperoxide isomerase ALOXE3 OS=Rattus norvegicus OX=10116 GN=Aloxe3 PE=1 SV=1
4	I3L1D5	0.0	648	664	0.476	0.503	I3L1D5_HUMAN Arachidonate 15-lipoxygenase type B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=1
5	O15296	0.0	674	676	0.488	0.506	LX15B_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=3
6	O35936	0.0	698	677	0.484	0.501	ALOX8_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX8 OS=Mus musculus OX=10090 GN=Alox8 PE=1 SV=1
7	O70582	0.0	1291	701	0.860	0.860	LX12B_MOUSE Arachidonate 12-lipoxygenase, 12R-type OS=Mus musculus OX=10090 GN=Alox12b PE=1 SV=1
8	O75342	0.0	1459	701	1.000	1.000	LX12B_HUMAN Arachidonate 12-lipoxygenase, 12R-type OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1
9	P09917	0.0	544	674	0.402	0.418	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
10	P12527	0.0	535	673	0.398	0.415	LOX5_RAT Polyunsaturated fatty acid 5-lipoxygenase OS=Rattus norvegicus OX=10116 GN=Alox5 PE=1 SV=3
11	P48999	0.0	542	674	0.399	0.415	LOX5_MOUSE Polyunsaturated fatty acid 5-lipoxygenase OS=Mus musculus OX=10090 GN=Alox5 PE=1 SV=3
12	Q2KMM4	0.0	1298	701	0.866	0.866	LX12B_RAT Arachidonate 12-lipoxygenase, 12R-type OS=Rattus norvegicus OX=10116 GN=Alox12b PE=1 SV=1
13	Q7T2A9	0.0	542	670	0.407	0.425	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
14	Q8K4F2	0.0	697	677	0.486	0.504	LX15B_RAT Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Rattus norvegicus OX=10116 GN=Alox15b PE=1 SV=1
15	Q9BYJ1	0.0	816	711	0.549	0.541	LOXE3_HUMAN Hydroperoxide isomerase ALOXE3 OS=Homo sapiens OX=9606 GN=ALOXE3 PE=1 SV=1
16	Q9WV07	0.0	817	711	0.558	0.550	LOXE3_MOUSE Hydroperoxide isomerase ALOXE3 OS=Mus musculus OX=10090 GN=Aloxe3 PE=1 SV=2
17	P18054	7.81e-154	462	663	0.362	0.383	LOX12_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Homo sapiens OX=9606 GN=ALOX12 PE=1 SV=4
18	F1LQ70	1.10e-153	462	663	0.359	0.380	LOX12_RAT Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Rattus norvegicus OX=10116 GN=Alox12 PE=1 SV=1
19	P39655	2.18e-152	459	663	0.359	0.380	LOX12_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Mus musculus OX=10090 GN=Alox12 PE=1 SV=4
20	P27479	3.26e-140	427	663	0.352	0.373	LOX15_BOVIN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Bos taurus OX=9913 GN=ALOX15 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00305 Lipoxygenase	4.5e-59	212.3	Lipoxygenase
2	PF01477 PLAT	1e-18	79.4	PLAT/LH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221307	0.927	Docosahexaenoic acid omega-hydroxylase CYP4F3
2	9606.ENSP00000354612	0.923	Prostaglandin G/H synthase 1
3	9606.ENSP00000221700	0.917	Phylloquinone omega-hydroxylase CYP4F2
4	9606.ENSP00000333212	0.917	Cytochrome P450 2U1
5	9606.ENSP00000356438	0.916	Prostaglandin G/H synthase 2
6	9606.ENSP00000458832	0.913	Arachidonate 15-lipoxygenase
7	9606.ENSP00000251535	0.911	Arachidonate 12-lipoxygenase, 12S-type
8	9606.ENSP00000360247	0.910	Cytochrome P450 2J2
9	9606.ENSP00000311095	0.909	Cytochrome P450 4A11
10	9606.ENSP00000360958	0.908	Cytochrome P450 4A22
11	9606.ENSP00000363512	0.908	Arachidonate 5-lipoxygenase
12	9606.ENSP00000477567	0.908	Cytochrome P450 4F8
13	9606.ENSP00000360317	0.906	Cytochrome P450 2C8
14	9606.ENSP00000369530	0.906	Arachidonate 15-lipoxygenase B
15	9606.ENSP00000260682	0.904	Cytochrome P450 2C9
16	9606.ENSP00000440689	0.902	Cytochrome P450 2E1
17	9606.ENSP00000360372	0.901	Cytochrome P450 2C19
18	9606.ENSP00000324648	0.900	Cytochrome P450 2B6
19	9606.ENSP00000311687	0.857	Magnesium transporter NIPA4
20	9606.ENSP00000269703	0.819	Cytochrome P450 family 4 subfamily F member 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016702	1.000	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0005515	0.967	protein binding
GO:0004052	0.788	arachidonate 12(S)-lipoxygenase activity
GO:0043167	0.501	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006690	0.986	icosanoid metabolic process
GO:0001676	0.986	long-chain fatty acid metabolic process
GO:0120254	0.961	olefinic compound metabolic process
GO:0033559	0.960	unsaturated fatty acid metabolic process
GO:0019369	0.954	arachidonic acid metabolic process
GO:0006633	0.692	fatty acid biosynthetic process
GO:0042759	0.361	long-chain fatty acid biosynthetic process
GO:0065007	0.325	biological regulation
GO:0050789	0.304	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.987	cytosol
GO:0043226	0.969	organelle
GO:0043227	0.961	membrane-bounded organelle
GO:0043229	0.960	intracellular organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0048471	0.902	perinuclear region of cytoplasm
GO:0016020	0.631	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	1.000	With incorporation of two atoms of oxygen.
RHEA:10428	0.788	(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate
EC:1.13.11.31	0.788	arachidonate 12-lipoxygenase.

[back to server]