StarFunc result for job id O75351

User Input

>input (444 residues)
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQL
QGAIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGK
SYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARENKPSIIFIDEIDSLC
GSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPL
PEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALMQPVRKVQSAT
HFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN
TKPTVNEHDLLKLKKFTEDFGQEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75351	1.000	1.000	9.129E-83	444	1.000	1.000	O75351.pdb.gz	VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2
2	AFDB:A0A0R4IPK7	0.853	0.752	1.091E-71	507	0.851	0.746	A0A0R4IPK7.pdb.gz	A0A0R4IPK7_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
3	AFDB:Q793F9	0.767	0.777	3.195E-69	437	0.806	0.819	Q793F9.pdb.gz	VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus OX=10116 GN=Vps4a PE=1 SV=1
4	AFDB:D0FH76	0.923	0.936	9.020E-69	438	0.777	0.788	D0FH76.pdb.gz	VPS4_BOMMO Vacuolar protein sorting-associated protein 4 OS=Bombyx mori OX=7091 GN=VPS4 PE=1 SV=1
5	AFDB:Q9Y162	0.900	0.904	2.840E-68	442	0.748	0.751	Q9Y162.pdb.gz	Q9Y162_DROME vesicle-fusing ATPase OS=Drosophila melanogaster OX=7227 GN=Vps4 PE=1 SV=1
6	AFDB:Q9BL83	0.764	0.789	1.277E-64	430	0.671	0.693	Q9BL83.pdb.gz	Q9BL83_CAEEL vesicle-fusing ATPase OS=Caenorhabditis elegans OX=6239 GN=vps-4 PE=1 SV=4
7	AFDB:Q54PT2	0.882	0.882	5.858E-57	444	0.586	0.586	Q54PT2.pdb.gz	VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum OX=44689 GN=vps4 PE=3 SV=1
8	AFDB:P52917	0.853	0.866	1.948E-56	437	0.601	0.611	P52917.pdb.gz	VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS4 PE=1 SV=1
9	AFDB:Q09803	0.746	0.765	5.206E-56	432	0.583	0.600	Q09803.pdb.gz	VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps4 PE=3 SV=1
10	AFDB:Q5AG40	0.866	0.875	2.154E-55	439	0.581	0.588	Q5AG40.pdb.gz	VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS4 PE=2 SV=1
11	PDB:2zanA	0.656	0.917	4.001E-46	312	0.678	0.965	2zanA.pdb.gz	Nucleotide-dependent conformational changes and assembly of the AAA ATPase SKD1/VPS4B
12	PDB:6ap1B	0.661	0.895	1.100E-42	322	0.511	0.705	6ap1B.pdb.gz	The AAA ATPase Vps4 binds ESCRT-III substrates through a repeating array of dipeptide-binding pockets.
13	PDB:6ugdE	0.585	0.810	5.359E-23	312	0.284	0.404	6ugdE.pdb.gz	Katanin Grips the beta-Tubulin Tail through an Electropositive Double Spiral to Sever Microtubules.
14	PDB:5wc1A	0.518	0.857	3.194E-20	262	0.248	0.420	5wc1A.pdb.gz
15	PDB:6fvtM	0.487	0.512	4.160E-19	421	0.198	0.209	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
16	PDB:7vcsA	0.559	0.332	8.462E-19	766	0.225	0.131	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
17	PDB:6opcB	0.540	0.331	2.142E-18	741	0.221	0.132	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
18	PDB:5mp9M	0.510	0.589	9.358E-18	381	0.221	0.257	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:5l4gL	0.508	0.575	2.790E-17	389	0.209	0.239	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
20	PDB:5l4gM	0.494	0.527	3.112E-17	415	0.196	0.210	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IPK7	0.0	755	507	0.860	0.753	A0A0R4IPK7_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
2	A5WWM0	0.0	760	437	0.867	0.881	A5WWM0_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
3	D0FH76	0.0	681	438	0.761	0.772	VPS4_BOMMO Vacuolar protein sorting-associated protein 4 OS=Bombyx mori OX=7091 GN=VPS4 PE=1 SV=1
4	O75351	0.0	915	444	1.000	1.000	VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2
5	P46467	0.0	834	444	0.955	0.955	VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus OX=10090 GN=Vps4b PE=1 SV=2
6	P52917	0.0	528	437	0.610	0.620	VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS4 PE=1 SV=1
7	Q54PT2	0.0	524	444	0.592	0.592	VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum OX=44689 GN=vps4 PE=3 SV=1
8	Q5AG40	0.0	520	439	0.588	0.595	VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS4 PE=2 SV=1
9	Q793F9	0.0	752	437	0.806	0.819	VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus OX=10116 GN=Vps4a PE=1 SV=1
10	Q8VEJ9	0.0	752	437	0.806	0.819	VPS4A_MOUSE Vacuolar protein sorting-associated protein 4A OS=Mus musculus OX=10090 GN=Vps4a PE=1 SV=1
11	Q9BL83	0.0	607	430	0.669	0.691	Q9BL83_CAEEL vesicle-fusing ATPase OS=Caenorhabditis elegans OX=6239 GN=vps-4 PE=1 SV=4
12	Q9UN37	0.0	750	437	0.802	0.815	VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1
13	Q9Y162	0.0	644	442	0.730	0.733	Q9Y162_DROME vesicle-fusing ATPase OS=Drosophila melanogaster OX=7227 GN=Vps4 PE=1 SV=1
14	Q57V58	1.91e-177	505	444	0.561	0.561	Q57V58_TRYB2 Katanin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.340 PE=3 SV=1
15	Q09803	2.40e-174	497	432	0.579	0.595	VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps4 PE=3 SV=1
16	E9AEB2	1.21e-162	468	445	0.536	0.535	E9AEB2_LEIMA vesicle-fusing ATPase OS=Leishmania major OX=5664 GN=VPS4 PE=3 SV=1
17	Q9ZNT0	1.81e-158	456	435	0.538	0.549	VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=SKD1 PE=1 SV=1
18	Q8IKQ5	1.07e-123	367	419	0.428	0.453	Q8IKQ5_PLAF7 Vacuolar protein sorting-associated protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1457500 PE=4 SV=1
19	B9DGC0	1.49e-84	266	393	0.338	0.382	B9DGC0_ARATH AT2G34560 protein OS=Arabidopsis thaliana OX=3702 GN=CCP1 PE=1 SV=1
20	Q9SEX2	1.31e-80	260	523	0.318	0.270	KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana OX=3702 GN=AAA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.1e-38	143.1	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.39	22.1	AAA domain
3	PF13191 AAA_16	0.044	25.6	AAA ATPase domain
4	PF13207 AAA_17	34	16.3	AAA domain
5	PF13238 AAA_18	0.8	21.7	AAA domain
6	PF07724 AAA_2	0.98	21.0	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	0.052	25.3	AAA domain
8	PF13479 AAA_24	36	15.5	AAA domain
9	PF13481 AAA_25	2	19.4	AAA domain
10	PF13671 AAA_33	13	17.4	AAA domain
11	PF07728 AAA_5	0.23	22.9	AAA domain (dynein-related subfamily)
12	PF12775 AAA_7	97	13.9	P-loop containing dynein motor region
13	PF17862 AAA_lid_3	0.00011	33.3	AAA+ lid domain
14	PF06745 ATPase	27	15.6	KaiC
15	PF20030 bpMoxR	2.8e+02	11.9	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
16	PF19263 DUF5906	2.6e+02	13.8	Family of unknown function (DUF5906)
17	PF05673 DUF815	1.8	19.2	Protein of unknown function (DUF815)
18	PF01695 IstB_IS21	0.26	22.3	IstB-like ATP binding protein
19	PF00493 MCM	5.3e+02	11.1	MCM P-loop domain
20	PF01078 Mg_chelatase	1.3e+02	13.4	Magnesium chelatase, subunit ChlI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380998	0.997	Charged multivesicular body protein 1a
2	9606.ENSP00000469240	0.997	Charged multivesicular body protein 2a
3	9606.ENSP00000263780	0.996	Charged multivesicular body protein 2b
4	9606.ENSP00000356602	0.995	Vacuolar protein sorting-associated protein VTA1 homolog
5	9606.ENSP00000432279	0.989	Charged multivesicular body protein 1b
6	9606.ENSP00000223500	0.988	Charged multivesicular body protein 5
7	9606.ENSP00000324205	0.988	Charged multivesicular body protein 4a
8	9606.ENSP00000438399	0.988	IST1 homolog
9	9606.ENSP00000317468	0.982	Charged multivesicular body protein 6
10	9606.ENSP00000217402	0.981	Charged multivesicular body protein 4b
11	9606.ENSP00000254950	0.975	Vacuolar protein sorting-associated protein 4A
12	9606.ENSP00000331201	0.961	Hepatocyte growth factor-regulated tyrosine kinase substrate
13	9606.ENSP00000411825	0.961	Programmed cell death 6-interacting protein
14	9606.ENSP00000297265	0.955	Charged multivesicular body protein 4c
15	9606.ENSP00000251968	0.949	Tumor susceptibility gene 101 protein
16	9606.ENSP00000366565	0.922	Vacuolar protein sorting-associated protein 28 homolog
17	9606.ENSP00000441543	0.907	Polyubiquitin-C
18	9606.ENSP00000304697	0.906	Polyubiquitin-B
19	9606.ENSP00000405575	0.906	Charged multivesicular body protein 3
20	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140657	0.968	ATP-dependent activity
GO:0003824	0.939	catalytic activity
GO:0097159	0.905	organic cyclic compound binding
GO:1901363	0.898	heterocyclic compound binding
GO:0016787	0.840	hydrolase activity
GO:0016887	0.833	ATP hydrolysis activity
GO:0044877	0.708	protein-containing complex binding
GO:0043167	0.562	ion binding
GO:0042802	0.555	identical protein binding
GO:0043168	0.419	anion binding
GO:0035639	0.371	purine ribonucleoside triphosphate binding
GO:0032555	0.350	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0051179	0.941	localization
GO:0016043	0.846	cellular component organization
GO:0065007	0.819	biological regulation
GO:0050789	0.811	regulation of biological process
GO:0008152	0.754	metabolic process
GO:0050794	0.753	regulation of cellular process
GO:0044237	0.684	cellular metabolic process
GO:0051234	0.605	establishment of localization
GO:0071704	0.600	organic substance metabolic process
GO:0044238	0.596	primary metabolic process
GO:0006807	0.585	nitrogen compound metabolic process
GO:0043170	0.568	macromolecule metabolic process
GO:0006810	0.552	transport
GO:0050896	0.517	response to stimulus
GO:0006996	0.499	organelle organization
GO:0044260	0.494	cellular macromolecule metabolic process
GO:0019058	0.442	viral life cycle
GO:0044248	0.433	cellular catabolic process
GO:0061919	0.412	process utilizing autophagic mechanism
GO:0010256	0.405	endomembrane system organization
GO:0051641	0.398	cellular localization
GO:1901564	0.370	organonitrogen compound metabolic process
GO:0051649	0.365	establishment of localization in cell
GO:0019538	0.357	protein metabolic process
GO:0048518	0.355	positive regulation of biological process
GO:0006914	0.352	autophagy
GO:0044085	0.351	cellular component biogenesis
GO:0022607	0.338	cellular component assembly
GO:0016192	0.330	vesicle-mediated transport
GO:0019068	0.321	virion assembly
GO:0046907	0.320	intracellular transport
GO:0048519	0.316	negative regulation of biological process
GO:0006508	0.315	proteolysis
GO:0044403	0.313	biological process involved in symbiotic interaction
GO:0046755	0.312	viral budding
GO:0048523	0.310	negative regulation of cellular process
GO:0048522	0.309	positive regulation of cellular process
GO:0051603	0.307	proteolysis involved in protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0012505	0.996	endomembrane system
GO:0016020	0.994	membrane
GO:0005829	0.983	cytosol
GO:0005576	0.979	extracellular region
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0005634	0.967	nucleus
GO:0031982	0.966	vesicle
GO:0030659	0.951	cytoplasmic vesicle membrane
GO:0010008	0.940	endosome membrane
GO:0070062	0.932	extracellular exosome
GO:0005886	0.848	plasma membrane
GO:0015630	0.763	microtubule cytoskeleton
GO:0030496	0.749	midbody
GO:0032991	0.613	protein-containing complex
GO:0005813	0.466	centrosome
GO:0070013	0.459	intracellular organelle lumen
GO:0005819	0.414	spindle
GO:0090543	0.377	Flemming body
GO:0031981	0.359	nuclear lumen
GO:0000922	0.356	spindle pole
GO:0098796	0.320	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.840	Hydrolases.
RHEA:13065	0.833	ATP + H2O = ADP + H(+) + phosphate

[back to server]