StarFunc result for job id O75352

User Input

>input (247 residues)
MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLP
QVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLV
MHYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNG
HTGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPP
HKQKKAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75352	1.000	1.000	1.488E-32	247	1.000	1.000	O75352.pdb.gz	MPU1_HUMAN Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens OX=9606 GN=MPDU1 PE=1 SV=2
2	AFDB:Q10227	0.647	0.574	6.588E-6	283	0.150	0.131	Q10227.pdb.gz	YD03_SCHPO Uncharacterized protein C2E12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E12.03c PE=4 SV=1
3	AFDB:Q5ADX1	0.527	0.529	4.874E-5	246	0.134	0.134	Q5ADX1.pdb.gz	Q5ADX1_CANAL PQ loop repeat protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C307670WA PE=4 SV=1
4	AFDB:Q9ZV02	0.644	0.620	5.847E-5	258	0.150	0.143	Q9ZV02.pdb.gz	SWET9_ARATH Bidirectional sugar transporter SWEET9 OS=Arabidopsis thaliana OX=3702 GN=SWEET9 PE=1 SV=1
5	AFDB:D3ZG79	0.534	0.386	1.105E-4	367	0.178	0.120	D3ZG79.pdb.gz	D3ZG79_RAT Cystinosin, lysosomal cystine transporter OS=Rattus norvegicus OX=10116 GN=Ctns PE=3 SV=2
6	AFDB:O44620	0.583	0.635	1.452E-4	224	0.142	0.156	O44620.pdb.gz	O44620_CAEEL Sugar transporter SWEET OS=Caenorhabditis elegans OX=6239 GN=swt-7 PE=1 SV=1
7	AFDB:Q2R3P9	0.575	0.482	1.996E-4	303	0.134	0.109	Q2R3P9.pdb.gz	SWT14_ORYSJ Bidirectional sugar transporter SWEET14 OS=Oryza sativa subsp. japonica OX=39947 GN=SWEET14 PE=2 SV=1
8	AFDB:Q9SMM5	0.630	0.550	2.745E-4	289	0.138	0.118	Q9SMM5.pdb.gz	SWT11_ARATH Bidirectional sugar transporter SWEET11 OS=Arabidopsis thaliana OX=3702 GN=SWEET11 PE=1 SV=1
9	AFDB:Q8LBF7	0.605	0.584	2.872E-4	258	0.126	0.120	Q8LBF7.pdb.gz	SWET7_ARATH Bidirectional sugar transporter SWEET7 OS=Arabidopsis thaliana OX=3702 GN=SWEET7 PE=1 SV=1
10	AFDB:Q84WN3	0.630	0.643	3.146E-4	241	0.130	0.133	Q84WN3.pdb.gz	SWT17_ARATH Bidirectional sugar transporter SWEET17 OS=Arabidopsis thaliana OX=3702 GN=SWEET17 PE=1 SV=2
11	PDB:7zkwA	0.524	0.531	2.447E-3	243	0.158	0.160	7zkwA.pdb.gz	Structural basis for proton coupled cystine transport by cystinosin.
12	PDB:8dypA	0.416	0.338	2.936E-3	326	0.182	0.138	8dypA.pdb.gz
13	PDB:5ctgB	0.570	0.626	1.258E-2	220	0.126	0.141	5ctgB.pdb.gz
14	PDB:6zxrA	0.414	0.465	6.182E-2	212	0.150	0.175	6zxrA.pdb.gz	A signal capture and proofreading mechanism for the KDEL-receptor explains selectivity and dynamic range in ER retrieval.
15	PDB:3craA	0.224	0.231	7.894E-1	239	0.065	0.067	3craA.pdb.gz
16	PDB:4qndA	0.293	0.688	8.645E-1	97	0.077	0.196	4qndA.pdb.gz
17	PDB:7oqzA	0.173	0.178	1.426	237	0.117	0.122	7oqzA.pdb.gz
18	PDB:2b6pA	0.164	0.159	1.710	261	0.142	0.134	2b6pA.pdb.gz
19	PDB:1h0nA	0.195	0.173	1.790	288	0.105	0.090	1h0nA.pdb.gz	Cobalt Substitution of Mouse R2 Ribonucleotide Reductase as a Model for Thereactive Diferrous State. Spectroscopic and Structural Evidence for a Ferromagnetically Coupled Dinuclear Cobalt Cluster
20	PDB:7sptA	0.137	0.084	1.790	470	0.117	0.062	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75352	1.52e-179	494	247	1.000	1.000	MPU1_HUMAN Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens OX=9606 GN=MPDU1 PE=1 SV=2
2	Q76M99	10.0	30.0	551	0.057	0.025	S22AO_RAT Steroid transmembrane transporter SLC22A24 OS=Rattus norvegicus OX=10116 GN=Slc22a24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04193 PQ-loop	1.7e-17	74.2	PQ loop repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360644	0.933	Dolichol-phosphate mannosyltransferase subunit 1
2	9606.ENSP00000360149	0.834	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
3	9606.ENSP00000322181	0.827	Dolichol phosphate-mannose biosynthesis regulatory protein
4	9606.ENSP00000363260	0.819	GPI mannosyltransferase 2
5	9606.ENSP00000357384	0.798	Dolichol-phosphate mannosyltransferase subunit 3
6	9606.ENSP00000299626	0.782	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
7	9606.ENSP00000347206	0.775	Glycosylphosphatidylinositol anchor attachment 1 protein
8	9606.ENSP00000353104	0.772	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
9	9606.ENSP00000367880	0.769	GPI ethanolamine phosphate transferase 3
10	9606.ENSP00000380793	0.769	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
11	9606.ENSP00000361625	0.765	Dolichyldiphosphatase 1
12	9606.ENSP00000420037	0.757	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
13	9606.ENSP00000216452	0.738	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
14	9606.ENSP00000359848	0.737	GPI-anchor transamidase
15	9606.ENSP00000399457	0.735	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
16	9606.ENSP00000333813	0.710	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
17	9606.ENSP00000389913	0.687	Pleckstrin homology domain-containing family M member 1
18	9606.ENSP00000430236	0.684	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
19	9606.ENSP00000164305	0.680	GPI mannosyltransferase 3
20	9606.ENSP00000350949	0.672	Mannose-1-phosphate guanyltransferase alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.407	transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006486	0.995	protein glycosylation
GO:0044255	0.994	cellular lipid metabolic process
GO:0006487	0.980	protein N-linked glycosylation
GO:0006490	0.969	oligosaccharide-lipid intermediate biosynthetic process
GO:0005975	0.900	carbohydrate metabolic process
GO:0009311	0.886	oligosaccharide metabolic process
GO:0009312	0.786	oligosaccharide biosynthetic process
GO:0006488	0.358	dolichol-linked oligosaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.981	endomembrane system
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005737	0.975	cytoplasm
GO:0031090	0.958	organelle membrane
GO:0005789	0.901	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]