StarFunc result for job id O75356

User Input

>input (428 residues)
MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGT
RIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHW
KKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTV
NFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTH
SYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGF
EPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAR
EVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHL
LQSLGISH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75356	1.000	1.000	1.504E-91	428	1.000	1.000	O75356.pdb.gz	ENTP5_HUMAN Nucleoside diphosphate phosphatase ENTPD5 OS=Homo sapiens OX=9606 GN=ENTPD5 PE=1 SV=1
2	AFDB:Q6P6S9	0.895	0.897	1.151E-79	427	0.836	0.838	Q6P6S9.pdb.gz	ENTP5_RAT Ectonucleoside triphosphate diphosphohydrolase 5 OS=Rattus norvegicus OX=10116 GN=Entpd5 PE=2 SV=1
3	AFDB:E7F8A7	0.885	0.842	2.791E-63	450	0.542	0.516	E7F8A7.pdb.gz	E7F8A7_DANRE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Danio rerio OX=7955 GN=entpd5a PE=3 SV=1
4	AFDB:O75354	0.866	0.768	2.801E-54	484	0.477	0.421	O75354.pdb.gz	ENTP6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens OX=9606 GN=ENTPD6 PE=1 SV=3
5	AFDB:Q9ER31	0.879	0.828	1.069E-53	455	0.481	0.453	Q9ER31.pdb.gz	ENTP6_RAT Ectonucleoside triphosphate diphosphohydrolase 6 OS=Rattus norvegicus OX=10116 GN=Entpd6 PE=1 SV=1
6	AFDB:M9PBV2	0.836	0.686	6.555E-46	524	0.357	0.292	M9PBV2.pdb.gz	M9PBV2_DROME NTPase, isoform F OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
7	AFDB:Q9VQI8	0.835	0.771	3.346E-45	464	0.348	0.321	Q9VQI8.pdb.gz	Q9VQI8_DROME FI18627p1 OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
8	AFDB:Q9XU84	0.833	0.747	5.619E-43	479	0.325	0.290	Q9XU84.pdb.gz	UDA1_CAEEL Nucleoside-diphosphatase uda-1 OS=Caenorhabditis elegans OX=6239 GN=uda-1 PE=1 SV=1
9	AFDB:Q8TGH6	0.756	0.550	3.579E-38	599	0.341	0.244	Q8TGH6.pdb.gz	GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDA1 PE=1 SV=1
10	AFDB:Q9FVC3	0.768	0.712	4.262E-38	463	0.306	0.283	Q9FVC3.pdb.gz	Q9FVC3_GLYSO Apyrase GS50 (Fragment) OS=Glycine soja OX=3848 PE=2 SV=1
11	PDB:6pbzA	0.458	0.411	2.202E-9	485	0.129	0.113	6pbzA.pdb.gz
12	PDB:1u6zB	0.445	0.390	2.622E-9	500	0.133	0.114	1u6zB.pdb.gz
13	PDB:4dchA	0.237	0.234	1.147E-5	434	0.077	0.076	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
14	PDB:6pbzD	0.363	0.347	1.289E-5	454	0.121	0.115	6pbzD.pdb.gz
15	PDB:5hfuB	0.321	0.182	2.913E-5	897	0.126	0.060	5hfuB.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
16	PDB:3idhA	0.301	0.289	3.897E-5	453	0.098	0.093	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
17	PDB:4ehtA	0.287	0.416	1.111E-4	268	0.096	0.153	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
18	PDB:7t1iB	0.331	0.416	2.369E-4	314	0.098	0.134	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
19	PDB:5i9eC	0.231	0.241	2.511E-4	404	0.103	0.109	5i9eC.pdb.gz	Crystal structure of a nuclear actin ternary complex.
20	PDB:6w6eI	0.207	0.236	2.511E-4	357	0.077	0.092	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75356	0.0	887	428	1.000	1.000	ENTP5_HUMAN Nucleoside diphosphate phosphatase ENTPD5 OS=Homo sapiens OX=9606 GN=ENTPD5 PE=1 SV=1
2	Q6P6S9	0.0	766	427	0.857	0.859	ENTP5_RAT Ectonucleoside triphosphate diphosphohydrolase 5 OS=Rattus norvegicus OX=10116 GN=Entpd5 PE=2 SV=1
3	Q9WUZ9	0.0	785	427	0.881	0.883	ENTP5_MOUSE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus OX=10090 GN=Entpd5 PE=1 SV=1
4	E7F8A7	2.92e-173	494	450	0.554	0.527	E7F8A7_DANRE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Danio rerio OX=7955 GN=entpd5a PE=3 SV=1
5	O75354	1.86e-132	391	484	0.472	0.417	ENTP6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens OX=9606 GN=ENTPD6 PE=1 SV=3
6	Q9ER31	6.70e-132	389	455	0.477	0.448	ENTP6_RAT Ectonucleoside triphosphate diphosphohydrolase 6 OS=Rattus norvegicus OX=10116 GN=Entpd6 PE=1 SV=1
7	Q5QPI9	2.31e-94	292	437	0.374	0.366	Q5QPI9_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens OX=9606 GN=ENTPD6 PE=1 SV=2
8	Q9VQI8	3.89e-85	270	464	0.364	0.336	Q9VQI8_DROME FI18627p1 OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
9	O76268	4.68e-85	269	461	0.364	0.338	O76268_DROME LD11641p OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
10	M9PBV2	3.51e-84	269	524	0.364	0.298	M9PBV2_DROME NTPase, isoform F OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
11	Q5QPJ6	8.86e-80	250	296	0.294	0.426	Q5QPJ6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 (Fragment) OS=Homo sapiens OX=9606 GN=ENTPD6 PE=1 SV=2
12	Q9XU84	6.08e-71	233	479	0.332	0.296	UDA1_CAEEL Nucleoside-diphosphatase uda-1 OS=Caenorhabditis elegans OX=6239 GN=uda-1 PE=1 SV=1
13	Q9UT35	2.06e-58	202	556	0.336	0.259	GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gdp1 PE=1 SV=1
14	Q8TGH6	4.73e-53	188	599	0.334	0.239	GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GDA1 PE=1 SV=1
15	Q9SQG2	5.64e-52	183	471	0.297	0.270	APY1_ARATH Apyrase 1 OS=Arabidopsis thaliana OX=3702 GN=APY1 PE=1 SV=1
16	P32621	3.22e-50	179	518	0.332	0.274	GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDA1 PE=1 SV=1
17	Q9FVC3	1.89e-49	176	463	0.294	0.272	Q9FVC3_GLYSO Apyrase GS50 (Fragment) OS=Glycine soja OX=3848 PE=2 SV=1
18	Q9FVC2	3.32e-49	176	468	0.297	0.271	Q9FVC2_GLYSO Apyrase GS52 OS=Glycine soja OX=3848 PE=2 SV=1
19	Q8IPZ6	2.61e-47	165	271	0.241	0.380	Q8IPZ6_DROME NTPase, isoform C OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
20	O80612	2.34e-39	150	555	0.297	0.229	APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana OX=3702 GN=APY6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01150 GDA1_CD39	3.9e-73	258.2	GDA1/CD39 (nucleoside phosphatase) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333019	0.958	Adenylosuccinate synthetase isozyme 1
2	9606.ENSP00000406261	0.954	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
3	9606.ENSP00000354238	0.953	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
4	9606.ENSP00000236959	0.928	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000369456	0.928	Inosine triphosphate pyrophosphatase
6	9606.ENSP00000355493	0.921	Adenylosuccinate synthetase isozyme 2
7	9606.ENSP00000362481	0.919	Uracil phosphoribosyltransferase homolog
8	9606.ENSP00000320171	0.917	Pyruvate kinase PKM
9	9606.ENSP00000232607	0.915	Uridine 5'-monophosphate synthase
10	9606.ENSP00000419851	0.907	GMP synthase [glutamine-hydrolyzing]
11	9606.ENSP00000367615	0.906	Adenine phosphoribosyltransferase
12	9606.ENSP00000259727	0.903	GMP reductase 1
13	9606.ENSP00000321584	0.903	Inosine-5'-monophosphate dehydrogenase 2
14	9606.ENSP00000339933	0.903	Pyruvate kinase PKLR
15	9606.ENSP00000345096	0.903	Inosine-5'-monophosphate dehydrogenase 1
16	9606.ENSP00000298556	0.900	Hypoxanthine-guanine phosphoribosyltransferase
17	9606.ENSP00000377814	0.900	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
18	9606.ENSP00000351520	0.899	Ectonucleoside triphosphate diphosphohydrolase 4
19	9606.ENSP00000307674	0.855	Soluble calcium-activated nucleotidase 1
20	9606.ENSP00000360250	0.817	Ectonucleoside triphosphate diphosphohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045134	1.000	UDP phosphatase activity
GO:0004382	1.000	GDP phosphatase activity
GO:0005515	0.970	protein binding
GO:0017111	0.525	ribonucleoside triphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:1901135	0.971	carbohydrate derivative metabolic process
GO:0044281	0.968	small molecule metabolic process
GO:1901564	0.966	organonitrogen compound metabolic process
GO:0006139	0.965	nucleobase-containing compound metabolic process
GO:0006753	0.956	nucleoside phosphate metabolic process
GO:0009259	0.932	ribonucleotide metabolic process
GO:0006220	0.925	pyrimidine nucleotide metabolic process
GO:0034655	0.913	nucleobase-containing compound catabolic process
GO:0046434	0.885	organophosphate catabolic process
GO:0009218	0.876	pyrimidine ribonucleotide metabolic process
GO:1901292	0.823	nucleoside phosphate catabolic process
GO:0009166	0.704	nucleotide catabolic process
GO:0009132	0.467	nucleoside diphosphate metabolic process
GO:1901136	0.466	carbohydrate derivative catabolic process
GO:0006458	0.434	'de novo' protein folding
GO:0009261	0.373	ribonucleotide catabolic process
GO:1901137	0.352	carbohydrate derivative biosynthetic process
GO:0044249	0.331	cellular biosynthetic process
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0070013	0.990	intracellular organelle lumen
GO:0005576	0.939	extracellular region
GO:0005783	0.747	endoplasmic reticulum
GO:0005615	0.694	extracellular space
GO:0005829	0.500	cytosol
GO:0016020	0.352	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:64876	1.000	H2O + UDP = H(+) + phosphate + UMP
RHEA:22156	1.000	GDP + H2O = GMP + H(+) + phosphate
EC:3.6.1.42	1.000	guanosine-diphosphatase.
RHEA:23680	0.525	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.525	nucleoside-triphosphate phosphatase.

[back to server]