StarFunc result for job id O75362

User Input

>input (1048 residues)
MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIE
GYMPLDCMFCSQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE
KNCKENEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNG
KSGARSKLQQGLESSPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK
KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQ
LATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEKCKHSHGEAPS
VDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC
SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFF
RSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQ
DTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQ
DFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLICRTKADVTPPPDGSTTHNLE
VSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAISLSKSLIPSITCPFCTFKTF
YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAF
PAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYF
CNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV
YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQ
HLSNSMAQKRNYENFIGNAHYRPNDKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75362	0.999	0.999	0.000	1048	1.000	1.000	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
2	AFDB:O15090	0.077	0.065	7.733E-33	1300	0.232	0.187	O15090.pdb.gz	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
3	AFDB:Q8K083	0.065	0.058	1.753E-31	1302	0.239	0.192	Q8K083.pdb.gz	ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus OX=10090 GN=Znf536 PE=1 SV=1
4	AFDB:Q7TSH3	0.061	0.056	1.316E-30	1157	0.244	0.221	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
5	AFDB:O54963	0.089	0.087	2.909E-11	1069	0.138	0.136	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
6	AFDB:Q9P1Z0	0.056	0.058	5.639E-9	1013	0.138	0.143	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
7	AFDB:Q8VIG1	0.089	0.086	7.806E-9	1082	0.142	0.138	Q8VIG1.pdb.gz	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
8	AFDB:A0A2R8QMX9	0.060	0.049	3.483E-8	1443	0.166	0.121	A0A2R8QMX9.pdb.gz
9	AFDB:Q9IA31	0.062	0.048	2.151E-7	1544	0.161	0.109	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
10	AFDB:F1QH64	0.067	0.061	4.399E-7	1225	0.158	0.136	F1QH64.pdb.gz
11	PDB:3w5kB	0.051	0.288	9.749E-3	110	0.025	0.236	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4c2mI	0.022	0.122	2.451	124	0.022	0.185	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
13	PDB:5zwmv	0.027	0.131	3.179	174	0.022	0.132	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
14	PDB:6gawAp	0.037	0.116	3.179	190	0.030	0.163	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
15	PDB:5apny	0.027	0.108	3.621	211	0.028	0.137	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:3j6b3	0.024	0.122	4.697	126	0.020	0.167	3j6b3.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:3j6bW	0.028	0.146	4.697	112	0.014	0.134	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
18	PDB:6rw4O	0.034	0.092	5.349	194	0.023	0.124	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
19	PDB:3gn5A	0.022	0.154	5.708	132	0.004	0.030	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
20	PDB:4v6iBl	0.032	0.169	5.708	88	0.012	0.148	4v6iBl.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75362	0.0	2178	1048	1.000	1.000	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
2	O15090	1.90e-69	256	1300	0.186	0.150	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
3	Q8K083	4.05e-67	249	1302	0.177	0.143	ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus OX=10090 GN=Znf536 PE=1 SV=1
4	Q92618	4.58e-55	211	1163	0.145	0.131	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
5	Q7TSH3	6.72e-52	201	1157	0.149	0.135	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
6	Q9P2J8	3.23e-23	108	865	0.112	0.135	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	F1QQA8	2.70e-21	102	1095	0.064	0.061	ZN219_DANRE Zinc finger protein 219 OS=Danio rerio OX=7955 GN=znf219 PE=1 SV=2
8	Q9P0L1	4.33e-21	101	754	0.097	0.135	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
9	Q8N7K0	6.88e-21	100	673	0.126	0.196	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
10	Q5MCW4	1.30e-20	100	686	0.108	0.165	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	Q9UII5	1.45e-20	100	783	0.121	0.162	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
12	Q96MU6	5.73e-20	98.2	729	0.118	0.170	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
13	Q9EQB9	5.89e-20	98.2	759	0.104	0.144	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
14	Q6ZN57	1.64e-19	95.1	461	0.097	0.221	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
15	P51523	1.76e-19	96.7	738	0.115	0.163	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
16	Q8IYB9	4.28e-19	95.1	648	0.114	0.184	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
17	Q9R164	1.27e-18	94.0	701	0.097	0.146	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
18	Q99K53	1.44e-18	93.6	700	0.097	0.146	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
19	Q5TYW1	1.60e-18	94.0	1059	0.125	0.124	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
20	Q6NX49	2.29e-18	92.8	715	0.107	0.157	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	5.4e-20	81.8	Zinc finger, C2H2 type
2	PF12756 zf-C2H2_2	33	16.2	C2H2 type zinc-finger (2 copies)
3	PF18868 zf-C2H2_3rep	1.2	21.3	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	5.7e-14	62.6	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	57	15.1	C2H2-type zinc finger
6	PF13465 zf-H2C2_2	0.00081	30.9	Zinc-finger double domain
7	PF13909 zf-H2C2_5	1.9	19.6	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262241	0.997	REST corepressor 1
2	9606.ENSP00000290921	0.992	C-terminal-binding protein 1
3	9606.ENSP00000383042	0.958	Lysine-specific histone demethylase 1A
4	9606.ENSP00000311825	0.931	C-terminal-binding protein 2
5	9606.ENSP00000430432	0.918	Histone deacetylase 2
6	9606.ENSP00000361066	0.892	Nuclear receptor coactivator 3
7	9606.ENSP00000405330	0.841	Estrogen receptor
8	9606.ENSP00000356331	0.805	Nuclear receptor subfamily 5 group A member 2
9	9606.ENSP00000320147	0.799	Histone-lysine N-methyltransferase EZH2
10	9606.ENSP00000379290	0.764	Breast carcinoma amplified sequence 1
11	9606.ENSP00000398824	0.754	PHD finger protein 21A
12	9606.ENSP00000356234	0.680	Lysine-specific demethylase 5B
13	9606.ENSP00000385995	0.679	Thyroid adenoma-associated protein
14	9606.ENSP00000362649	0.663	Histone deacetylase 1
15	9606.ENSP00000359837	0.660	ZZ-type zinc finger-containing protein 3
16	9606.ENSP00000301459	0.649	REST corepressor 2
17	9606.ENSP00000438553	0.635	Histone H2A.J
18	9606.ENSP00000298717	0.630	N6-adenosine-methyltransferase catalytic subunit
19	9606.ENSP00000413929	0.630	REST corepressor 3
20	9606.ENSP00000367022	0.625	Histone H2A type 1-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.998	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008134	0.428	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0080090	0.993	regulation of primary metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0010556	0.979	regulation of macromolecule biosynthetic process
GO:0031326	0.979	regulation of cellular biosynthetic process
GO:0051252	0.977	regulation of RNA metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0010605	0.971	negative regulation of macromolecule metabolic process
GO:0048523	0.966	negative regulation of cellular process
GO:0051172	0.961	negative regulation of nitrogen compound metabolic process
GO:0031324	0.961	negative regulation of cellular metabolic process
GO:0045892	0.917	negative regulation of DNA-templated transcription
GO:0006357	0.902	regulation of transcription by RNA polymerase II
GO:0000122	0.889	negative regulation of transcription by RNA polymerase II
GO:0009987	0.568	cellular process
GO:0048518	0.393	positive regulation of biological process
GO:0050896	0.383	response to stimulus
GO:0048522	0.346	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.956	protein-containing complex
GO:0005737	0.930	cytoplasm
GO:1902494	0.826	catalytic complex
GO:0016604	0.720	nuclear body
GO:0005739	0.580	mitochondrion
GO:0140513	0.571	nuclear protein-containing complex
GO:0016607	0.334	nuclear speck
GO:0000118	0.320	histone deacetylase complex
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]