StarFunc result for job id O75366

User Input

>input (819 residues)
MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVA
SGMKHVETNTYDVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESN
SGERLKAMLLAKDIRDRERGGRAKIGVIEGDKEAASPELMKVLQDTLGRRSIIKPTVPDE
IIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGA
TKAEKQAAMSKALGFIKMKSYPSSTNVETVNDGAESAMFKQLFQKWSVKDQTMGLGKTFS
IGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWYGFFYG
GDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGT
EPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSN
DVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQEPAEFWDLLGGKTP
YANDKRLQQEILDVQSRLFECSNKTGQFVVTEITDFTQDDLNPTDVMLLDTWDQVFLWIG
AEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFEPPIFTGWFLAWDPNIWSAGK
TYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQELPEDVNPAK
KENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75366	1.000	1.000	0.000	819	1.000	1.000	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
2	AFDB:O88398	0.646	0.646	0.000	819	0.894	0.894	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
3	AFDB:P09327	0.610	0.604	0.000	827	0.612	0.606	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
4	AFDB:O15195	0.816	0.783	7.037E-104	856	0.468	0.447	O15195.pdb.gz	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
5	AFDB:P06396	0.795	0.831	8.936E-93	782	0.414	0.434	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
6	PDB:6jegB	0.782	0.887	4.416E-89	718	0.409	0.467	6jegB.pdb.gz
7	AFDB:A0A0R4IQ11	0.289	0.327	5.305E-83	720	0.440	0.500	A0A0R4IQ11.pdb.gz
8	AFDB:Q5ZIV9	0.271	0.308	2.878E-81	717	0.416	0.476	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
9	AFDB:E9PU64	0.275	0.313	6.825E-81	715	0.420	0.481	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
10	AFDB:Q07171	0.734	0.752	1.304E-77	798	0.328	0.337	Q07171.pdb.gz	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
11	AFDB:O81644	0.655	0.562	1.305E-74	976	0.336	0.282	O81644.pdb.gz	VILI2_ARATH Villin-2 OS=Arabidopsis thaliana OX=3702 GN=VLN2 PE=1 SV=2
12	PDB:1j72A	0.128	0.303	2.315E-32	337	0.188	0.457	1j72A.pdb.gz
13	PDB:7cccB	0.089	0.196	1.031E-5	342	0.050	0.120	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:6g2dC	0.084	0.040	6.942E-4	2121	0.081	0.031	6g2dC.pdb.gz
15	PDB:6g2iA	0.089	0.044	6.942E-4	2080	0.076	0.030	6g2iA.pdb.gz
16	PDB:5cskB	0.079	0.043	1.257E-3	2017	0.074	0.030	5cskB.pdb.gz
17	PDB:5cskA	0.079	0.043	1.646E-3	1996	0.083	0.034	5cskA.pdb.gz
18	PDB:5cslB	0.078	0.042	1.834E-3	2072	0.092	0.036	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
19	PDB:5cslA	0.072	0.040	1.149E-2	2050	0.079	0.032	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
20	PDB:5kynA	0.092	0.103	1.149E-2	730	0.059	0.066	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMJ1	0.0	694	720	0.438	0.499	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
2	B4DV78	0.0	642	516	0.376	0.597	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1
3	E9PU64	0.0	681	715	0.426	0.488	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
4	G1U9R8	0.0	651	739	0.419	0.464	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
5	O15195	0.0	764	856	0.471	0.451	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
6	O75366	0.0	1706	819	1.000	1.000	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
7	O88398	0.0	1528	819	0.895	0.895	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
8	P06396	0.0	652	782	0.416	0.436	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
9	P09327	0.0	1060	827	0.611	0.605	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
10	P13020	0.0	648	780	0.415	0.436	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
11	P20305	0.0	652	772	0.416	0.442	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
12	Q28046	0.0	684	715	0.426	0.488	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
13	Q5ZIV9	0.0	689	717	0.421	0.481	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
14	Q60604	0.0	678	715	0.424	0.485	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
15	Q62468	0.0	1035	827	0.595	0.589	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
16	Q68FP1	0.0	641	780	0.411	0.432	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
17	Q7TQ08	0.0	679	715	0.425	0.487	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
18	Q9WU06	0.0	1528	819	0.896	0.896	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
19	Q9Y6U3	0.0	686	715	0.433	0.497	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
20	Q07171	2.13e-132	415	798	0.344	0.353	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	1.7e-92	314.7	Gelsolin repeat
2	PF02209 VHP	3.4e-13	60.6	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263238	0.819	Actin-related protein 3
2	9606.ENSP00000263071	0.755	Scavenger receptor class F member 1
3	9606.ENSP00000375881	0.674	Alkaline phosphatase, placental
4	9606.ENSP00000376368	0.654	Wiskott-Aldrich syndrome protein family member 1
5	9606.ENSP00000367220	0.647	Actin-related protein 2
6	9606.ENSP00000390600	0.644	Sodium channel protein type 10 subunit alpha
7	9606.ENSP00000421377	0.641	Piezo-type mechanosensitive ion channel component 2
8	9606.ENSP00000347484	0.622	Thrombospondin type-1 domain-containing protein 4
9	9606.ENSP00000460823	0.617	TOM1-like protein 1
10	9606.ENSP00000209668	0.611	Alcohol dehydrogenase 1A, alpha polypeptide
11	9606.ENSP00000209718	0.601	Keratin, type I cytoskeletal 23
12	9606.ENSP00000327234	0.597	Transmembrane and coiled-coil domains 5A
13	9606.ENSP00000386306	0.565	Sodium channel protein type 9 subunit alpha
14	9606.ENSP00000256935	0.563	Dedicator of cytokinesis protein 2
15	9606.ENSP00000252699	0.537	Alpha-actinin-4
16	9606.ENSP00000300209	0.518	EEF1A lysine methyltransferase 3
17	9606.ENSP00000348128	0.515	Supervillin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.988	protein-containing complex binding
GO:0051015	0.961	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.987	cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048522	0.971	positive regulation of cellular process
GO:0031344	0.970	regulation of cell projection organization
GO:0051130	0.957	positive regulation of cellular component organization
GO:0031346	0.953	positive regulation of cell projection organization
GO:0120035	0.952	regulation of plasma membrane bounded cell projection organization
GO:0030029	0.913	actin filament-based process
GO:0032501	0.900	multicellular organismal process
GO:0071840	0.888	cellular component organization or biogenesis
GO:0016043	0.884	cellular component organization
GO:0030036	0.863	actin cytoskeleton organization
GO:0044087	0.827	regulation of cellular component biogenesis
GO:0048856	0.816	anatomical structure development
GO:1902743	0.751	regulation of lamellipodium organization
GO:0010975	0.728	regulation of neuron projection development
GO:0044085	0.627	cellular component biogenesis
GO:0007275	0.563	multicellular organism development
GO:0048731	0.407	system development
GO:0022607	0.360	cellular component assembly
GO:0019222	0.354	regulation of metabolic process
GO:0007015	0.353	actin filament organization
GO:0007399	0.347	nervous system development
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0120025	0.977	plasma membrane bounded cell projection
GO:0005856	0.946	cytoskeleton
GO:0016020	0.931	membrane
GO:0005737	0.929	cytoplasm
GO:0015629	0.916	actin cytoskeleton
GO:0005829	0.913	cytosol
GO:0031982	0.833	vesicle
GO:0005576	0.823	extracellular region
GO:0071944	0.814	cell periphery
GO:0005886	0.769	plasma membrane
GO:0043231	0.753	intracellular membrane-bounded organelle
GO:0030054	0.694	cell junction
GO:0030055	0.666	cell-substrate junction
GO:0005925	0.620	focal adhesion
GO:0031252	0.596	cell leading edge
GO:0005615	0.393	extracellular space
GO:0030027	0.362	lamellipodium
GO:0099080	0.358	supramolecular complex
GO:0099512	0.340	supramolecular fiber
GO:0032991	0.322	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]