StarFunc result for job id O75368

User Input

>input (114 residues)
MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPA
TGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75368	1.000	1.000	2.032E-23	114	1.000	1.000	O75368.pdb.gz	SH3L1_HUMAN Adapter SH3BGRL OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1
2	PDB:1u6tA	0.945	0.892	3.419E-20	121	0.982	0.926	1u6tA.pdb.gz
3	PDB:1wryA	0.907	0.856	1.043E-18	121	0.947	0.893	1wryA.pdb.gz
4	AFDB:Q8BG73	0.879	0.935	5.031E-16	107	0.561	0.598	Q8BG73.pdb.gz	SH3L2_MOUSE SH3 domain-binding glutamic acid-rich-like protein 2 OS=Mus musculus OX=10090 GN=Sh3bgrl2 PE=1 SV=1
5	PDB:2ct6A	0.803	0.824	1.176E-12	111	0.579	0.595	2ct6A.pdb.gz
6	AFDB:Q9NFP5	0.790	0.578	3.144E-11	158	0.342	0.247	Q9NFP5.pdb.gz	SH3BG_DROME SH3 domain-binding glutamic acid-rich protein homolog OS=Drosophila melanogaster OX=7227 GN=Sh3beta PE=1 SV=2
7	AFDB:B2RZ27	0.732	0.889	4.962E-9	93	0.307	0.376	B2RZ27.pdb.gz	SH3L3_RAT SH3 domain-binding glutamic acid-rich-like protein 3 OS=Rattus norvegicus OX=10116 GN=Sh3bgrl3 PE=1 SV=1
8	PDB:1sj6A	0.692	0.814	5.279E-7	95	0.307	0.368	1sj6A.pdb.gz
9	AFDB:Q57X23	0.713	0.323	1.965E-6	270	0.175	0.074	Q57X23.pdb.gz	Q57X23_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.210 PE=3 SV=1
10	AFDB:Q5T123	0.567	0.726	4.317E-5	88	0.228	0.295	Q5T123.pdb.gz	Q5T123_HUMAN SH3 domain binding glutamate rich protein like 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
11	AFDB:Q9LH89	0.725	0.209	1.320E-4	428	0.167	0.044	Q9LH89.pdb.gz	Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabidopsis thaliana OX=3702 GN=At3g28850 PE=4 SV=1
12	AFDB:A0A140LFN7	0.699	0.290	2.091E-4	295	0.158	0.061	A0A140LFN7.pdb.gz
13	AFDB:P43597	0.654	0.070	2.233E-4	1233	0.158	0.015	P43597.pdb.gz	YFI6_YEAST Uncharacterized protein YFR016C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFR016C PE=1 SV=1
14	AFDB:A0A1D8PPH3	0.633	0.091	2.384E-4	896	0.167	0.021	A0A1D8PPH3.pdb.gz	A0A1D8PPH3_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AIP5 PE=1 SV=1
15	PDB:3grxA	0.572	0.756	3.102E-4	82	0.158	0.220	3grxA.pdb.gz	NMR structure of Escherichia coli glutaredoxin 3-glutathione mixed disulfide complex: implications for the enzymatic mechanism.
16	PDB:3qmxA	0.570	0.645	4.914E-4	99	0.175	0.202	3qmxA.pdb.gz
17	PDB:4n11A	0.535	0.559	1.013E-3	108	0.140	0.148	4n11A.pdb.gz	Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
18	PDB:3uiwA	0.565	0.582	2.087E-3	110	0.105	0.109	3uiwA.pdb.gz	A New Mode of Iron-sulfur Cluster Coordination in Glutaredoxins is Crucial for Axonogenesis
19	PDB:1grxA	0.447	0.553	6.379E-3	85	0.184	0.247	1grxA.pdb.gz	NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
20	PDB:5j3rA	0.525	0.525	7.770E-3	114	0.088	0.088	5j3rA.pdb.gz	Crystal structure of yeast monothiol glutaredoxin Grx6 in complex with a glutathione-coordinated [2Fe-2S] cluster

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75368	7.00e-81	234	114	1.000	1.000	SH3L1_HUMAN Adapter SH3BGRL OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1
2	Q8BG73	7.90e-44	140	107	0.561	0.598	SH3L2_MOUSE SH3 domain-binding glutamic acid-rich-like protein 2 OS=Mus musculus OX=10090 GN=Sh3bgrl2 PE=1 SV=1
3	Q9UJC5	1.03e-43	140	107	0.588	0.626	SH3L2_HUMAN SH3 domain-binding glutamic acid-rich-like protein 2 OS=Homo sapiens OX=9606 GN=SH3BGRL2 PE=1 SV=2
4	Q9NFP5	8.58e-19	78.2	158	0.395	0.285	SH3BG_DROME SH3 domain-binding glutamic acid-rich protein homolog OS=Drosophila melanogaster OX=7227 GN=Sh3beta PE=1 SV=2
5	Q9H299	9.08e-13	61.2	93	0.325	0.398	SH3L3_HUMAN SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
6	B2RZ27	3.39e-12	59.7	93	0.316	0.387	SH3L3_RAT SH3 domain-binding glutamic acid-rich-like protein 3 OS=Rattus norvegicus OX=10116 GN=Sh3bgrl3 PE=1 SV=1
7	Q5T123	6.65e-05	40.8	88	0.228	0.295	Q5T123_HUMAN SH3 domain binding glutamate rich protein like 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
8	D3UAG2	0.73	31.2	481	0.158	0.037	U71K2_PYRCO UDP-glycosyltransferase 71K2 OS=Pyrus communis OX=23211 GN=UGT71K2 PE=1 SV=1
9	F1NTD3	3.3	29.3	502	0.088	0.020	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
10	O00238	3.3	29.3	502	0.088	0.020	BMR1B_HUMAN Bone morphogenetic protein receptor type-1B OS=Homo sapiens OX=9606 GN=BMPR1B PE=1 SV=1
11	P36898	3.3	29.3	502	0.088	0.020	BMR1B_MOUSE Bone morphogenetic protein receptor type-1B OS=Mus musculus OX=10090 GN=Bmpr1b PE=1 SV=1
12	Q05438	3.3	29.3	502	0.088	0.020	BMR1B_CHICK Bone morphogenetic protein receptor type-1B OS=Gallus gallus OX=9031 GN=BMPR1B PE=1 SV=1
13	Q12386	4.3	28.9	881	0.202	0.026	ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP8 PE=1 SV=1
14	A0A8I5ZJI2	4.8	28.9	502	0.088	0.020	A0A8I5ZJI2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
15	A0A8I5ZXN2	4.8	28.9	550	0.088	0.018	A0A8I5ZXN2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
16	A0A8I6A0G0	4.8	28.9	550	0.088	0.018	A0A8I6A0G0_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
17	M0R3J4	4.8	28.9	491	0.088	0.020	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
18	Q569A5	4.8	28.5	297	0.088	0.034	Q569A5_RAT receptor protein serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=2 SV=1
19	P9WJT7	5.9	28.5	1146	0.132	0.013	MMPLC_MYCTU Probable transport protein MmpL12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmpL12 PE=3 SV=1
20	C0L3D6	6.5	28.5	535	0.088	0.019	C0L3D6_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=alk6b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00462 Glutaredoxin	1.2	20.8	Glutaredoxin
2	PF04908 SH3BGR	3.4e-43	157.2	SH3-binding, glutamic acid-rich protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003038

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005195	0.548	CKLF-like MARVEL transmembrane domain containing 6
2	61853.ENSNLEP00000004006	0.532	Uncharacterized protein
3	61853.ENSNLEP00000004033	0.532	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.986	protein binding
GO:0140517	0.613	protein-RNA adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051247	0.991	positive regulation of protein metabolic process
GO:0031325	0.990	positive regulation of cellular metabolic process
GO:0006417	0.989	regulation of translation
GO:0006511	0.989	ubiquitin-dependent protein catabolic process
GO:0010628	0.988	positive regulation of gene expression
GO:0045727	0.983	positive regulation of translation
GO:0006446	0.976	regulation of translational initiation
GO:0043161	0.975	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:2000765	0.973	regulation of cytoplasmic translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005634	0.998	nucleus
GO:0031982	0.992	vesicle
GO:0005576	0.990	extracellular region
GO:0005615	0.955	extracellular space
GO:0070062	0.947	extracellular exosome
GO:0043233	0.912	organelle lumen
GO:0070013	0.839	intracellular organelle lumen
GO:0031981	0.489	nuclear lumen
GO:0005654	0.410	nucleoplasm
GO:0016020	0.366	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]