StarFunc result for job id O75369

User Input

>input (2602 residues)
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JXT8	0.210	0.210	0.000	2602	0.956	0.956	A0A0G2JXT8.pdb.gz	A0A0G2JXT8_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
2	AFDB:P21333	0.211	0.208	0.000	2647	0.699	0.687	P21333.pdb.gz	FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4
3	AFDB:Q9VEN1	0.186	0.213	0.000	2210	0.417	0.491	Q9VEN1.pdb.gz	FLNA_DROME Filamin-A OS=Drosophila melanogaster OX=7227 GN=cher PE=1 SV=2
4	AFDB:U4PBJ9	0.209	0.233	0.000	2259	0.294	0.339	U4PBJ9.pdb.gz	U4PBJ9_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
5	AFDB:Q9TYW4	0.131	0.293	3.806E-83	1084	0.138	0.330	Q9TYW4.pdb.gz	Q9TYW4_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
6	AFDB:Q95U66	0.079	0.147	1.090E-82	1148	0.106	0.240	Q95U66.pdb.gz	Q95U66_DROME GH03118p OS=Drosophila melanogaster OX=7227 GN=jbug PE=2 SV=1
7	AFDB:P13466	0.081	0.243	8.772E-60	857	0.095	0.289	P13466.pdb.gz	GELA_DICDI Gelation factor OS=Dictyostelium discoideum OX=44689 GN=abpC PE=1 SV=1
8	AFDB:P76347	0.087	0.093	6.353E-45	2358	0.102	0.113	P76347.pdb.gz	YEEJ_ECOLI Uncharacterized protein YeeJ OS=Escherichia coli (strain K12) OX=83333 GN=yeeJ PE=3 SV=3
9	AFDB:Q9D2F7	0.088	0.108	3.397E-40	1881	0.091	0.126	Q9D2F7.pdb.gz	P210L_MOUSE Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2
10	AFDB:Q54IS9	0.073	0.087	5.448E-38	1916	0.080	0.109	Q54IS9.pdb.gz	Q54IS9_DICDI Nucleoporin 210 OS=Dictyostelium discoideum OX=44689 GN=nup210 PE=3 SV=1
11	PDB:7sqcO0	0.074	0.141	1.773E-18	1140	0.047	0.108	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:1e07A	0.066	0.181	3.414E-16	642	0.028	0.114	1e07A.pdb.gz
13	PDB:5a42A	0.058	0.086	8.523E-16	1597	0.055	0.090	5a42A.pdb.gz
14	PDB:7q1yA	0.045	0.074	4.773E-14	1374	0.044	0.083	7q1yA.pdb.gz
15	PDB:4lnvA	0.048	0.082	5.231E-14	1276	0.038	0.078	4lnvA.pdb.gz
16	PDB:7q5zA	0.072	0.110	7.774E-13	1344	0.042	0.081	7q5zA.pdb.gz
17	PDB:6h03A	0.060	0.108	1.854E-12	1223	0.039	0.083	6h03A.pdb.gz
18	PDB:7nycA	0.055	0.084	1.941E-12	1542	0.040	0.067	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4d1eA	0.080	0.239	1.387E-11	859	0.032	0.097	4d1eA.pdb.gz
20	PDB:5oj2B	0.069	0.174	2.632E-11	692	0.033	0.126	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXT8	5074	2602	0.956	0.956	A0A0G2JXT8_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
2	A0A0R4IUS4	2956	2702	0.594	0.572	A0A0R4IUS4_DANRE Filamin C, gamma a (actin-binding protein 280) OS=Danio rerio OX=7955 GN=flnca PE=1 SV=1
3	A0A8I5Y6H8	3444	2450	0.650	0.690	A0A8I5Y6H8_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
4	A0A8I5Y7V6	1494	2537	0.364	0.373	A0A8I5Y7V6_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
5	A0A8I5ZV49	3703	2647	0.700	0.688	A0A8I5ZV49_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
6	A0A8I6GK95	4959	2556	0.939	0.955	A0A8I6GK95_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
7	D0IMZ5	842	2255	0.225	0.260	D0IMZ5_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
8	D0IMZ6	666	836	0.131	0.408	D0IMZ6_CAEEL FiLamiN (Actin binding protein) homolog OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
9	D0IMZ7	849	2204	0.223	0.263	D0IMZ7_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
10	D0IMZ8	850	2206	0.223	0.263	D0IMZ8_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
11	D3ZHA0	3127	2726	0.623	0.594	FLNC_RAT Filamin-C OS=Rattus norvegicus OX=10116 GN=Flnc PE=1 SV=1
12	D4A8D5	5014	2578	0.947	0.956	D4A8D5_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
13	E7EN95	4858	2409	0.921	0.995	E7EN95_HUMAN Filamin B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=1
14	O75369	5308	2602	1.000	1.000	FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2
15	P21333	3705	2647	0.702	0.690	FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4
16	Q14315	3125	2725	0.624	0.596	FLNC_HUMAN Filamin-C OS=Homo sapiens OX=9606 GN=FLNC PE=1 SV=3
17	Q60FE5	3699	2620	0.702	0.697	Q60FE5_HUMAN Filamin A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=1
18	Q80X90	5085	2602	0.958	0.958	FLNB_MOUSE Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3
19	Q8BTM8	3696	2647	0.699	0.687	FLNA_MOUSE Filamin-A OS=Mus musculus OX=10090 GN=Flna PE=1 SV=5
20	Q8VHX6	3126	2726	0.624	0.595	FLNC_MOUSE Filamin-C OS=Mus musculus OX=10090 GN=Flnc PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16640 Big_3_5	3e-07	41.9	Bacterial Ig-like domain (group 3)
2	PF19079 CFSR	6.8e-10	50.4	Collagen-flanked surface repeat
3	PF00307 CH	9.1e-35	130.5	Calponin homology (CH) domain
4	PF09912 DUF2141	0.02	26.2	Uncharacterized protein conserved in bacteria (DUF2141)
5	PF12975 DUF3859	2.7e+02	12.9	Domain of unknown function (DUF3859)
6	PF16586 DUF5060	5.6e-07	41.2	Domain of unknown function (DUF5060)
7	PF19410 DUF5980	4e+02	12.9	Family of unknown function (DUF5980)
8	PF00630 Filamin	0	1244.5	Filamin/ABP280 repeat
9	PF09134 Invasin_D3	2.9e-06	39.0	Invasin, domain 3
10	PF13954 PapC_N	3e+02	12.8	PapC N-terminal domain
11	PF13115 YtkA	0.00063	31.6	YtkA-like
12	PF07495 Y_Y_Y	4.3e-13	60.3	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358866	0.979	Filamin-A
2	9606.ENSP00000287156	0.927	Ubiquitin/ISG15-conjugating enzyme E2 L6
3	9606.ENSP00000329380	0.926	Platelet glycoprotein Ib alpha chain
4	9606.ENSP00000264350	0.912	E3 ISG15--protein ligase HERC5
5	9606.ENSP00000323889	0.912	E3 ubiquitin/ISG15 ligase TRIM25
6	9606.ENSP00000369217	0.907	E3 ubiquitin-protein ligase ARIH1
7	9606.ENSP00000368699	0.896	Ubiquitin-like protein ISG15
8	9606.ENSP00000410402	0.882	Dual specificity mitogen-activated protein kinase kinase 4
9	9606.ENSP00000327145	0.853	Filamin-C
10	9606.ENSP00000416387	0.852	Filamin-binding LIM protein 1
11	9606.ENSP00000339740	0.850	Calcium/calmodulin-dependent protein kinase type II subunit delta
12	9606.ENSP00000278568	0.829	Serine/threonine-protein kinase PAK 1
13	9606.ENSP00000381412	0.827	Calcium/calmodulin-dependent protein kinase type II subunit alpha
14	9606.ENSP00000379098	0.822	Calcium/calmodulin-dependent protein kinase type II subunit beta
15	9606.ENSP00000379350	0.818	Integrin beta-1
16	9606.ENSP00000200181	0.784	Integrin beta-4
17	9606.ENSP00000283249	0.775	Integrin beta-6
18	9606.ENSP00000386896	0.767	Integrin alpha-6
19	9606.ENSP00000452786	0.767	Integrin beta-3
20	9606.ENSP00000382423	0.734	Mitogen-activated protein kinase kinase kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008092	0.943	cytoskeletal protein binding
GO:0044877	0.880	protein-containing complex binding
GO:0097159	0.824	organic cyclic compound binding
GO:1901363	0.823	heterocyclic compound binding
GO:0003676	0.783	nucleic acid binding
GO:0042802	0.754	identical protein binding
GO:0045296	0.549	cadherin binding
GO:0003779	0.361	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.965	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0048856	0.940	anatomical structure development
GO:0030154	0.936	cell differentiation
GO:0032501	0.908	multicellular organismal process
GO:0071840	0.887	cellular component organization or biogenesis
GO:0016043	0.883	cellular component organization
GO:0050896	0.879	response to stimulus
GO:0030029	0.819	actin filament-based process
GO:0009653	0.806	anatomical structure morphogenesis
GO:0006996	0.802	organelle organization
GO:0007010	0.706	cytoskeleton organization
GO:0051716	0.571	cellular response to stimulus
GO:0048468	0.563	cell development
GO:0007154	0.487	cell communication
GO:0007165	0.468	signal transduction
GO:0008152	0.394	metabolic process
GO:0007275	0.378	multicellular organism development
GO:0071704	0.375	organic substance metabolic process
GO:0009888	0.371	tissue development
GO:0048518	0.363	positive regulation of biological process
GO:0030036	0.339	actin cytoskeleton organization
GO:0048522	0.312	positive regulation of cellular process
GO:0044238	0.308	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043228	0.995	non-membrane-bounded organelle
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0005634	0.981	nucleus
GO:0005856	0.978	cytoskeleton
GO:0005886	0.974	plasma membrane
GO:0015629	0.967	actin cytoskeleton
GO:0042995	0.954	cell projection
GO:0120025	0.900	plasma membrane bounded cell projection
GO:0031982	0.894	vesicle
GO:0036477	0.875	somatodendritic compartment
GO:0043005	0.849	neuron projection
GO:0044297	0.848	cell body
GO:0005576	0.831	extracellular region
GO:0030054	0.815	cell junction
GO:0030055	0.805	cell-substrate junction
GO:0005925	0.794	focal adhesion
GO:0043025	0.772	neuronal cell body
GO:0043230	0.730	extracellular organelle
GO:1903561	0.712	extracellular vesicle
GO:0099081	0.685	supramolecular polymer
GO:0099512	0.683	supramolecular fiber
GO:0070062	0.671	extracellular exosome
GO:0005654	0.446	nucleoplasm
GO:0032991	0.305	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]