StarFunc result for job id O75373

User Input

>input (536 residues)
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYRNLVFLGIVVSKPDLITCLEQGK
KPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESV
DECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGK
AFNQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCEDCGKAFSR
FSYLTAHKIIHSGEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSIL
TAHKIIHSGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSLTTHK
IIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFKYSSSLTTHKIIHT
GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKP
YKCERCGKAFKRSFILTRHKRIHTGEKPYKCEECGKGFKCPSTLTTHKVIHTGEKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35789	0.704	0.620	4.043E-72	620	0.784	0.677	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
2	AFDB:Q03923	0.447	0.408	3.306E-70	595	0.787	0.709	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
3	AFDB:Q14593	0.463	0.441	6.346E-69	569	0.724	0.682	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
4	AFDB:A6NNF4	0.611	0.452	9.218E-68	738	0.739	0.537	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	AFDB:Q05481	0.387	0.205	8.572E-67	1191	0.731	0.329	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
6	AFDB:Q03936	0.478	0.441	5.396E-66	586	0.750	0.686	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	AFDB:Q8TD23	0.517	0.490	8.911E-66	568	0.731	0.690	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
8	AFDB:O75437	0.615	0.508	1.224E-64	659	0.716	0.583	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
9	AFDB:Q9H8G1	0.548	0.521	2.390E-64	570	0.707	0.665	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
10	AFDB:Q96JC4	0.523	0.534	1.654E-62	524	0.662	0.677	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
11	PDB:3w5kB	0.094	0.290	3.307E-4	110	0.078	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.057	0.108	2.092	208	0.069	0.178	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:7tveG	0.060	0.092	2.615	307	0.058	0.101	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
14	PDB:7ajuCK	0.062	0.131	2.923	222	0.065	0.158	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:5n61R	0.073	0.104	3.091	303	0.049	0.086	5n61R.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
16	PDB:6vk0C	0.066	0.142	3.268	180	0.039	0.117	6vk0C.pdb.gz
17	PDB:6lss4	0.063	0.056	3.455	620	0.071	0.061	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
18	PDB:5gm6a	0.035	0.111	3.863	123	0.041	0.179	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7nvr3	0.061	0.109	4.084	214	0.050	0.126	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
20	PDB:5c8dE	0.069	0.102	4.318	280	0.037	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	550	616	0.532	0.463	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	546	659	0.530	0.431	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	536	809	0.541	0.358	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	545	620	0.515	0.445	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	814	595	0.785	0.708	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	786	586	0.741	0.677	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	546	1191	0.537	0.242	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	772	569	0.724	0.682	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	623	474	0.569	0.643	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	761	569	0.707	0.666	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	678	536	0.666	0.666	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	657	444	0.601	0.725	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	526	646	0.522	0.433	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	587	515	0.578	0.602	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	714	648	0.668	0.552	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	732	542	0.677	0.670	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8IYX0	535	411	0.511	0.667	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
18	Q8TAQ5	536	688	0.552	0.430	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
19	Q8TD23	771	568	0.724	0.683	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
20	Q96H40	688	463	0.632	0.732	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06397 Desulfoferrod_N	68	14.5	Desulfoferrodoxin, N-terminal domain
2	PF12552 DUF3741	2.6	19.3	Protein of unknown function (DUF3741)
3	PF14432 DYW_deaminase	8.8e+02	11.1	DYW family of nucleic acid deaminases
4	PF08150 FerB	5e+02	12.7	FerB (NUC096) domain
5	PF07754 HVO_2753_ZBP	1.2e+02	13.9	Small zinc finger protein HVO_2753-like, Zn-binding pocket
6	PF01352 KRAB	2.8e-19	79.7	KRAB box
7	PF01286 XPA_N	1.5e-16	71.4	XPA protein N-terminal
8	PF01428 zf-AN1	0.67	21.5	AN1-like Zinc finger
9	PF00096 zf-C2H2	6.9e-60	207.4	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	0.0003	31.8	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	1.4e-33	123.7	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	9.3e-23	90.9	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	1.3e-16	71.6	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	4.7e-103	344.7	Zinc-finger double domain
15	PF02591 zf-RING_7	1.7e-05	36.2	C4-type zinc ribbon domain
16	PF13451 zf-trcl	0.16	23.2	Probable zinc-ribbon domain
17	PF18439 zf_UBZ	5.2e-12	56.5	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	0.44	22.7	zinc-ribbon family
19	PF09723 Zn-ribbon_8	1.6e-07	42.6	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	9.9e-06	36.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008953760.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009889	0.969	regulation of biosynthetic process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0048519	0.936	negative regulation of biological process
GO:0009890	0.927	negative regulation of biosynthetic process
GO:0031324	0.910	negative regulation of cellular metabolic process
GO:0006355	0.907	regulation of DNA-templated transcription
GO:0051253	0.896	negative regulation of RNA metabolic process
GO:0031327	0.892	negative regulation of cellular biosynthetic process
GO:0010558	0.889	negative regulation of macromolecule biosynthetic process
GO:1902679	0.876	negative regulation of RNA biosynthetic process
GO:1903507	0.871	negative regulation of nucleic acid-templated transcription
GO:0045892	0.859	negative regulation of DNA-templated transcription
GO:0009987	0.732	cellular process
GO:0032501	0.473	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]