StarFunc result for job id O75376

User Input

>input (2440 residues)
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESV
ETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFP
MDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALY
QRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPE
GVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPK
PSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQ
EGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKG
REEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKR
ESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEG
SISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKA
GETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMN
RTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVY
RSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITS
QQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRP
GSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPA
GGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAV
SEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELR
TRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPAS
SPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMG
QVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHE
KQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSG
GGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVE
DHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIP
GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTP
IACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q4C2	0.104	0.105	0.000	2404	0.589	0.598	A0A2R8Q4C2.pdb.gz
2	AFDB:Q60974	0.251	0.251	0.000	2453	0.920	0.916	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
3	AFDB:D3ZXN9	0.124	0.122	3.511E-96	2472	0.409	0.404	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
4	AFDB:Q9Y618	0.076	0.074	1.171E-94	2514	0.420	0.407	Q9Y618.pdb.gz	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
5	AFDB:E7FF48	0.142	0.148	2.693E-94	2315	0.390	0.411	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
6	PDB:4czzB	0.028	0.483	1.890E-4	133	0.011	0.195	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
7	AFDB:Q9Y2F5	0.041	0.043	2.281E-4	2266	0.115	0.124	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
8	AFDB:Q00083	0.032	0.044	2.893E-4	1676	0.120	0.174	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
9	PDB:5l3cB	0.027	0.467	2.436E-3	134	0.011	0.209	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
10	AFDB:Q8IJP9	0.031	0.031	3.120E-3	2578	0.110	0.104	Q8IJP9.pdb.gz	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
11	AFDB:Q9W1X4	0.026	0.035	3.120E-3	1711	0.093	0.132	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
12	AFDB:O46048	0.028	0.029	4.730E-3	2342	0.113	0.117	O46048.pdb.gz	O46048_DROME EG:133E12.4 protein OS=Drosophila melanogaster OX=7227 GN=east PE=1 SV=1
13	PDB:2cjjA	0.017	0.601	6.512E-1	63	0.004	0.143	2cjjA.pdb.gz
14	PDB:7aoaD	0.021	0.138	1.252	343	0.007	0.047	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
15	PDB:6lthO	0.022	0.142	2.269	325	0.007	0.055	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:6k15D	0.018	0.130	3.242	305	0.005	0.043	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
17	PDB:6elzv	0.017	0.226	3.441	130	0.006	0.108	6elzv.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
18	PDB:7z0sG	0.021	0.119	3.875	250	0.004	0.036	7z0sG.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
19	PDB:7qooU	0.018	0.143	4.112	186	0.010	0.134	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:2cyyA	0.017	0.237	4.364	151	0.002	0.040	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JU91	0.0	789	2511	0.177	0.172	A0A0G2JU91_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
2	A0A8I6AN60	0.0	749	2453	0.172	0.171	A0A8I6AN60_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
3	A8B6H7	0.0	2309	2409	0.593	0.601	A8B6H7_DANRE Nuclear receptor co-repressor OS=Danio rerio OX=7955 GN=ncor PE=1 SV=1
4	C9J0Q5	0.0	784	2504	0.180	0.175	C9J0Q5_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=2
5	C9JE98	0.0	783	2458	0.180	0.179	C9JE98_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
6	C9JQE8	0.0	774	1451	0.176	0.296	C9JQE8_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
7	D3ZXN9	0.0	788	2477	0.177	0.174	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
8	E7EVK1	0.0	2161	1071	0.435	0.991	E7EVK1_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2
9	E7EVU5	0.0	1089	537	0.216	0.983	E7EVU5_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
10	E7EW50	0.0	1122	545	0.223	0.998	E7EW50_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
11	E7FF48	0.0	757	2315	0.199	0.210	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
12	J3KS51	0.0	1098	546	0.220	0.982	J3KS51_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
13	O75376	0.0	4990	2440	1.000	1.000	NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2
14	Q60974	0.0	4138	2453	0.918	0.913	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
15	Q9WU42	0.0	789	2472	0.180	0.177	NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus OX=10090 GN=Ncor2 PE=1 SV=3
16	Q9WUB5	0.0	898	533	0.196	0.899	NCOR1_RAT Nuclear receptor corepressor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ncor1 PE=1 SV=1
17	J3QKP0	8.97e-136	425	217	0.088	0.991	J3QKP0_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
18	J3KS29	4.21e-115	364	184	0.075	0.995	J3KS29_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
19	C9JAP0	4.09e-78	256	125	0.051	1.000	C9JAP0_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
20	Q9VYK0	2.22e-69	263	3601	0.060	0.041	Q9VYK0_DROME Smrter, isoform D OS=Drosophila melanogaster OX=7227 GN=Smr PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16055 DUF4798	53	15.2	Domain of unknown function (DUF4798)
2	PF15784 GPS2_interact	4.2e-32	121.7	G-protein pathway suppressor 2-interacting domain
3	PF00249 Myb_DNA-binding	5.5e-14	63.4	Myb-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	6.3	18.4	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268712

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217964	0.999	F-box-like/WD repeat-containing protein TBL1X
2	9606.ENSP00000246672	0.999	Nuclear receptor subfamily 1 group D member 1
3	9606.ENSP00000254066	0.999	Retinoic acid receptor alpha
4	9606.ENSP00000264606	0.999	Histone deacetylase 4
5	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000302967	0.999	Histone deacetylase 3
7	9606.ENSP00000356426	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
8	9606.ENSP00000362649	0.999	Histone deacetylase 1
9	9606.ENSP00000370104	0.999	G protein pathway suppressor 2
10	9606.ENSP00000378402	0.999	Paired amphipathic helix protein Sin3a
11	9606.ENSP00000384371	0.999	B-cell lymphoma 6 protein
12	9606.ENSP00000385523	0.999	Peroxisome proliferator-activated receptor alpha
13	9606.ENSP00000405330	0.999	Estrogen receptor
14	9606.ENSP00000405574	0.999	F-box-like/WD repeat-containing protein TBL1XR1
15	9606.ENSP00000363822	0.998	Androgen receptor
16	9606.ENSP00000212015	0.997	NAD-dependent protein deacetylase sirtuin-1
17	9606.ENSP00000264637	0.997	Thyroid hormone receptor alpha
18	9606.ENSP00000395535	0.997	Methyl-CpG-binding protein 2
19	9606.ENSP00000225983	0.995	Histone deacetylase 5
20	9606.ENSP00000345206	0.995	Recombining binding protein suppressor of hairless

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0003714	1.000	transcription corepressor activity
GO:0046965	0.999	nuclear retinoid X receptor binding
GO:0043565	0.995	sequence-specific DNA binding
GO:1990837	0.986	sequence-specific double-stranded DNA binding
GO:0000976	0.980	transcription cis-regulatory region binding
GO:0019904	0.877	protein domain specific binding
GO:0046966	0.854	nuclear thyroid hormone receptor binding
GO:0098772	0.827	molecular function regulator activity
GO:0030234	0.774	enzyme regulator activity
GO:0035033	0.635	histone deacetylase regulator activity
GO:0019899	0.422	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0009987	0.985	cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0009889	0.983	regulation of biosynthetic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0010468	0.978	regulation of gene expression
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0048523	0.941	negative regulation of cellular process
GO:0006357	0.926	regulation of transcription by RNA polymerase II
GO:0048518	0.881	positive regulation of biological process
GO:0045934	0.879	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.878	negative regulation of macromolecule metabolic process
GO:0009890	0.878	negative regulation of biosynthetic process
GO:0045892	0.868	negative regulation of DNA-templated transcription
GO:0050896	0.840	response to stimulus
GO:0051173	0.832	positive regulation of nitrogen compound metabolic process
GO:0010604	0.832	positive regulation of macromolecule metabolic process
GO:0048583	0.820	regulation of response to stimulus
GO:0000122	0.788	negative regulation of transcription by RNA polymerase II
GO:0032502	0.753	developmental process
GO:0008152	0.738	metabolic process
GO:0048856	0.732	anatomical structure development
GO:0048522	0.723	positive regulation of cellular process
GO:0071704	0.696	organic substance metabolic process
GO:0032501	0.680	multicellular organismal process
GO:0043170	0.660	macromolecule metabolic process
GO:0031325	0.624	positive regulation of cellular metabolic process
GO:0023051	0.612	regulation of signaling
GO:0010646	0.612	regulation of cell communication
GO:0009966	0.553	regulation of signal transduction
GO:0051716	0.548	cellular response to stimulus
GO:0044238	0.492	primary metabolic process
GO:0045935	0.432	positive regulation of nucleobase-containing compound metabolic process
GO:0006807	0.422	nitrogen compound metabolic process
GO:0045893	0.406	positive regulation of DNA-templated transcription
GO:0007275	0.403	multicellular organism development
GO:0051246	0.375	regulation of protein metabolic process
GO:0045944	0.372	positive regulation of transcription by RNA polymerase II
GO:0048731	0.332	system development
GO:0042221	0.326	response to chemical
GO:0048513	0.305	animal organ development
GO:0030154	0.304	cell differentiation
GO:0071840	0.303	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.969	protein-containing complex
GO:0005667	0.760	transcription regulator complex
GO:0043232	0.552	intracellular non-membrane-bounded organelle
GO:0005694	0.492	chromosome
GO:0000785	0.467	chromatin
GO:0017053	0.421	transcription repressor complex
GO:0016020	0.354	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]