StarFunc result for job id O75380

User Input

>input (124 residues)
MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ
KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR
QHHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75380	1.000	1.000	1.891E-25	124	1.000	1.000	O75380.pdb.gz	NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1
2	AFDB:P23934	0.800	0.800	2.724E-23	124	0.831	0.831	P23934.pdb.gz	NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS6 PE=1 SV=2
3	AFDB:P52503	0.830	0.886	1.291E-21	116	0.790	0.845	P52503.pdb.gz	NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs6 PE=1 SV=2
4	PDB:7qskR	0.765	0.984	1.828E-18	96	0.694	0.896	7qskR.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	PDB:7b93R	0.758	0.975	5.558E-18	96	0.685	0.885	7b93R.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
6	AFDB:Q19724	0.659	0.585	1.111E-10	140	0.427	0.379	Q19724.pdb.gz	NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nduf-6 PE=3 SV=1
7	AFDB:Q9M9M6	0.477	0.535	1.200E-6	110	0.266	0.300	Q9M9M6.pdb.gz	NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g03070 PE=1 SV=1
8	PDB:7a23P	0.461	0.777	4.971E-5	71	0.194	0.338	7a23P.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
9	AFDB:Q586Z4	0.408	0.223	4.259E-3	236	0.210	0.110	Q586Z4.pdb.gz	Q586Z4_TRYB2 Zinc-finger domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.1060 PE=4 SV=1
10	AFDB:G8BCY3	0.304	0.250	1.476E-2	154	0.185	0.149	G8BCY3.pdb.gz	G8BCY3_CANPC Cytochrome c oxidase polypeptide IV, mitochondrial OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=COX4 PE=4 SV=1
11	AFDB:P90849	0.259	0.247	4.486E-2	132	0.121	0.114	P90849.pdb.gz	P90849_CAEEL COX5B-domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cox-5b PE=1 SV=1
12	PDB:7dgqA5	0.260	0.317	1.549E-1	98	0.105	0.133	7dgqA5.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
13	AFDB:P12075	0.264	0.255	2.155E-1	129	0.161	0.155	P12075.pdb.gz	COX5B_RAT Cytochrome c oxidase subunit 5B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox5b PE=1 SV=2
14	PDB:7oqyY	0.148	0.190	7.943E-1	92	0.121	0.163	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	AFDB:H0YCH8	0.208	0.176	1.436	151	0.137	0.113	H0YCH8.pdb.gz	H0YCH8_HUMAN A-kinase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=AKIP1 PE=1 SV=1
16	PDB:2airB	0.191	0.162	1.741	153	0.056	0.046	2airB.pdb.gz	T-State Active Site of Aspartate Transcarbamylase: Crystal Structure of the Carbamyl Phosphate and l-Alanosine Ligated Enzyme
17	PDB:2d2aA	0.129	0.136	1.859	114	0.089	0.096	2d2aA.pdb.gz
18	PDB:7pzyJ	0.159	0.091	1.859	203	0.121	0.074	7pzyJ.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:7mq8L8	0.141	0.103	2.578	180	0.105	0.072	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:2jr7A	0.175	0.238	2.752	84	0.048	0.071	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75380	1.73e-90	259	124	1.000	1.000	NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1
2	P23934	4.96e-75	220	124	0.831	0.831	NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS6 PE=1 SV=2
3	P52503	2.94e-69	205	116	0.790	0.845	NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs6 PE=1 SV=2
4	Q19724	4.77e-24	91.7	140	0.379	0.336	NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nduf-6 PE=3 SV=1
5	Q9M9M6	5.15e-09	52.4	110	0.290	0.327	NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g03070 PE=1 SV=1
6	Q9UQW6	0.21	32.7	395	0.145	0.046	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
7	A0A5F9ZHL1	0.23	32.7	434	0.121	0.035	A0A5F9ZHL1_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
8	A0A5F9ZI66	0.33	32.3	322	0.105	0.040	A0A5F9ZI66_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
9	A0A5F9ZHD4	0.35	32.3	306	0.105	0.042	A0A5F9ZHD4_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
10	P17764	0.44	32.0	424	0.137	0.040	THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acat1 PE=1 SV=1
11	A0A140VJX1	0.48	32.0	427	0.105	0.030	A0A140VJX1_HUMAN Testicular tissue protein Li 198 OS=Homo sapiens OX=9606 PE=2 SV=1
12	P24752	0.48	32.0	427	0.105	0.030	THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
13	A0A5F9ZHJ0	0.49	32.0	337	0.105	0.039	A0A5F9ZHJ0_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
14	Q86AD9	0.82	31.2	414	0.105	0.031	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
15	Q8QZT1	0.85	31.2	424	0.105	0.031	THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Acat1 PE=1 SV=1
16	Q8S4Y1	1.2	30.8	403	0.105	0.032	ACCT2_ARATH Acetyl-CoA acetyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=ACCT2 PE=1 SV=1
17	Q680K8	4.7	28.9	329	0.113	0.043	Y1576_ARATH BTB/POZ domain-containing protein At1g55760 OS=Arabidopsis thaliana OX=3702 GN=At1g55760 PE=2 SV=1
18	Q46939	5.4	28.9	393	0.113	0.036	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
19	Q9FIK7	6.9	28.5	415	0.097	0.029	AACT1_ARATH Acetyl-CoA acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=ACCT1 PE=1 SV=1
20	P13437	7.4	28.5	397	0.113	0.035	THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acaa2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02803 Thiolase_C	82	14.3	Thiolase, C-terminal domain
2	PF10276 zf-CHCC	2.9e-14	64.1	Zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000013613

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001838	0.999	NADH:ubiquinone oxidoreductase core subunit S7
2	61853.ENSNLEP00000001848	0.999	Uncharacterized protein
3	61853.ENSNLEP00000003939	0.999	Uncharacterized protein
4	61853.ENSNLEP00000006495	0.999	NADH:ubiquinone oxidoreductase subunit B6
5	61853.ENSNLEP00000006643	0.999	NADH:ubiquinone oxidoreductase subunit B9
6	61853.ENSNLEP00000006986	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
7	61853.ENSNLEP00000007076	0.999	NADH:ubiquinone oxidoreductase subunit B5
8	61853.ENSNLEP00000007648	0.999	Uncharacterized protein
9	61853.ENSNLEP00000007894	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
10	61853.ENSNLEP00000007936	0.999	NADH:ubiquinone oxidoreductase core subunit S8
11	61853.ENSNLEP00000008465	0.999	NADH:ubiquinone oxidoreductase core subunit V2
12	61853.ENSNLEP00000008644	0.999	NADH:ubiquinone oxidoreductase core subunit S1
13	61853.ENSNLEP00000009366	0.999	NADH:ubiquinone oxidoreductase subunit B4
14	61853.ENSNLEP00000010813	0.999	NADH:ubiquinone oxidoreductase subunit B10
15	61853.ENSNLEP00000013438	0.999	NADH:ubiquinone oxidoreductase subunit S4
16	61853.ENSNLEP00000016410	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
17	61853.ENSNLEP00000016627	0.999	NADH:ubiquinone oxidoreductase subunit B7
18	61853.ENSNLEP00000016724	0.999	Uncharacterized protein
19	61853.ENSNLEP00000017110	0.999	NADH:ubiquinone oxidoreductase subunit C1
20	61853.ENSNLEP00000017296	0.999	NADH:ubiquinone oxidoreductase core subunit S2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0003824	0.998	catalytic activity
GO:0005515	0.981	protein binding
GO:0022857	0.691	transmembrane transporter activity
GO:0016491	0.663	oxidoreductase activity
GO:0097159	0.502	organic cyclic compound binding
GO:0009055	0.499	electron transfer activity
GO:1901363	0.498	heterocyclic compound binding
GO:0022804	0.439	active transmembrane transporter activity
GO:0015399	0.368	primary active transmembrane transporter activity
GO:0015453	0.355	oxidoreduction-driven active transmembrane transporter activity
GO:0016740	0.313	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044237	0.993	cellular metabolic process
GO:0006091	0.975	generation of precursor metabolites and energy
GO:0045333	0.968	cellular respiration
GO:0010257	0.958	NADH dehydrogenase complex assembly
GO:0033108	0.948	mitochondrial respiratory chain complex assembly
GO:0071704	0.912	organic substance metabolic process
GO:0032981	0.912	mitochondrial respiratory chain complex I assembly
GO:0044238	0.910	primary metabolic process
GO:0022904	0.606	respiratory electron transport chain
GO:0032502	0.520	developmental process
GO:0048856	0.482	anatomical structure development
GO:0032501	0.473	multicellular organismal process
GO:0044281	0.444	small molecule metabolic process
GO:0007275	0.384	multicellular organism development
GO:0043436	0.351	oxoacid metabolic process
GO:0019752	0.338	carboxylic acid metabolic process
GO:0009060	0.313	aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.999	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.663	Oxidoreductases.
EC:7.-.-.-	0.368	Translocases.
EC:2.-.-.-	0.313	Transferases.

[back to server]