StarFunc result for job id O75381

User Input

>input (377 residues)
MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTD
EEIDMAFQQSGTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIA
FGFHQLYKKYLLPLILGGREDRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQ
QQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPS
WQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGE
GVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQ
VEKLRRPEGASNESERD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75381	1.000	1.000	4.120E-52	377	1.000	1.000	O75381.pdb.gz	PEX14_HUMAN Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1
2	AFDB:P78723	0.217	0.229	2.955E-7	351	0.215	0.231	P78723.pdb.gz	PEX14_PICAN Peroxisomal membrane protein PEX14 OS=Pichia angusta OX=870730 GN=PEX14 PE=3 SV=1
3	AFDB:P53112	0.182	0.200	5.651E-7	341	0.186	0.205	P53112.pdb.gz	PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX14 PE=1 SV=1
4	AFDB:A0A1B0GWK2	0.151	0.074	8.050E-4	863	0.175	0.076	A0A1B0GWK2.pdb.gz	A0A1B0GWK2_HUMAN Kazrin, periplakin interacting protein OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=1
5	AFDB:A0A0G2K7W4	0.181	0.074	1.113E-3	1348	0.170	0.047	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
6	AFDB:A0A0G2K490	0.136	0.049	1.643E-3	1360	0.194	0.054	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
7	AFDB:A0A0R4IEP9	0.154	0.054	2.759E-3	1332	0.170	0.048	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
8	AFDB:Q9LT23	0.111	0.122	3.576E-3	337	0.156	0.175	Q9LT23.pdb.gz	BH121_ARATH Transcription factor bHLH121 OS=Arabidopsis thaliana OX=3702 GN=BHLH121 PE=1 SV=1
9	AFDB:O74814	0.130	0.127	4.072E-3	387	0.186	0.181	O74814.pdb.gz	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
10	AFDB:P21127	0.226	0.121	4.635E-3	795	0.156	0.074	P21127.pdb.gz	CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens OX=9606 GN=CDK11B PE=1 SV=4
11	PDB:4v6wCD	0.075	0.094	5.566E-1	290	0.032	0.041	4v6wCD.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:8escE	0.120	0.104	8.763E-1	440	0.034	0.030	8escE.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
13	PDB:7egdD	0.081	0.147	1.136	197	0.048	0.091	7egdD.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:2n5gA	0.098	0.296	1.212	101	0.040	0.149	2n5gA.pdb.gz
15	PDB:5wlcST	0.164	0.108	1.212	599	0.053	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
16	PDB:7d5sRN	0.165	0.108	1.293	607	0.061	0.038	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:7shfC	0.093	0.088	1.380	400	0.034	0.033	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
18	PDB:4h63H	0.080	0.137	1.472	174	0.077	0.167	4h63H.pdb.gz
19	PDB:6zqaUB	0.164	0.127	1.472	504	0.050	0.038	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
20	PDB:7c4jH	0.159	0.230	1.788	242	0.048	0.074	7c4jH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75381	0.0	762	377	1.000	1.000	PEX14_HUMAN Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1
2	Q642G4	0.0	660	376	0.926	0.928	PEX14_RAT Peroxisomal membrane protein PEX14 OS=Rattus norvegicus OX=10116 GN=Pex14 PE=1 SV=1
3	Q9R0A0	0.0	653	376	0.915	0.918	PEX14_MOUSE Peroxisomal membrane protein PEX14 OS=Mus musculus OX=10090 GN=Pex14 PE=1 SV=1
4	Q9Z2Z3	0.0	628	377	0.920	0.920	PEX14_CRILO Peroxisomal membrane protein PEX14 OS=Cricetulus longicaudatus OX=10030 GN=PEX14 PE=2 SV=1
5	Q9VPB8	2.12e-26	108	280	0.204	0.275	Q9VPB8_DROME Peroxisomal membrane protein PEX14 OS=Drosophila melanogaster OX=7227 GN=Pex14 PE=1 SV=1
6	P53112	1.35e-17	85.1	341	0.172	0.191	PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX14 PE=1 SV=1
7	Q9HG09	2.31e-14	76.3	425	0.164	0.146	PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris OX=4922 GN=PEX14 PE=1 SV=1
8	P78723	7.87e-14	74.3	351	0.170	0.182	PEX14_PICAN Peroxisomal membrane protein PEX14 OS=Pichia angusta OX=870730 GN=PEX14 PE=3 SV=1
9	Q9FXT6	1.55e-09	61.6	507	0.133	0.099	PEX14_ARATH Peroxisomal membrane protein PEX14 OS=Arabidopsis thaliana OX=3702 GN=PEX14 PE=1 SV=2
10	O60065	1.05e-08	58.2	286	0.095	0.126	PEX14_SCHPO Peroxisomal membrane protein pex14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pex14 PE=3 SV=1
11	Q38CL4	8.55e-07	52.8	366	0.080	0.082	Q38CL4_TRYB2 Peroxisomal membrane protein PEX14 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0130 PE=3 SV=1
12	Q8IEW2	8.55e-07	52.8	366	0.080	0.082	Q8IEW2_TRYBB Peroxisomal membrane protein PEX14 OS=Trypanosoma brucei brucei OX=5702 GN=PEX14 PE=1 SV=1
13	Q4QBZ9	6.08e-04	43.9	464	0.172	0.140	Q4QBZ9_LEIMA Peroxisomal membrane protein PEX14 OS=Leishmania major OX=5664 GN=PEX14 PE=3 SV=1
14	P11103	1.8	33.1	1013	0.093	0.035	PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus OX=10090 GN=Parp1 PE=1 SV=3
15	Q96PV1	4.2	32.0	704	0.053	0.028	Q96PV1_HUMAN KIAA1937 protein (Fragment) OS=Homo sapiens OX=9606 GN=KIAA1937 PE=2 SV=1
16	Q8I643	4.8	32.0	2178	0.042	0.007	Q8I643_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1200100 PE=4 SV=1
17	Q9V785	5.8	31.6	477	0.061	0.048	3BP5H_DROME SH3 domain-binding protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=pcs PE=1 SV=4
18	Q9Y6N6	6.0	31.6	1575	0.053	0.013	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
19	A5HUK9	9.1	30.8	340	0.122	0.135	A5HUK9_CHICK BG antigen OS=Gallus gallus OX=9031 GN=BG1 PE=4 SV=1
20	Q7Z406	9.3	31.2	1995	0.074	0.014	MYH14_HUMAN Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05791 Bacillus_HBL	1.9e+02	13.3	Bacillus haemolytic enterotoxin (HBL)
2	PF06103 DUF948	15	17.2	Bacterial protein of unknown function (DUF948)
3	PF04695 Pex14_N	4.7e-14	63.0	Pex14 N-terminal domain
4	PF16331 TolA_bind_tri	7.6e+02	11.6	TolA binding protein trimerisation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349016

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295030	0.999	Peroxisomal membrane protein PEX13
2	9606.ENSP00000357051	0.999	Peroxisomal biogenesis factor 19
3	9606.ENSP00000391601	0.999	Peroxisomal targeting signal 1 receptor
4	9606.ENSP00000315680	0.998	Peroxisomal targeting signal 2 receptor
5	9606.ENSP00000482609	0.993	Peroxisome assembly protein 12
6	9606.ENSP00000419975	0.991	PEX5-related protein
7	9606.ENSP00000241041	0.986	Peroxisomal membrane protein PEX16
8	9606.ENSP00000349543	0.985	Peroxisome biogenesis factor 2
9	9606.ENSP00000390722	0.984	Peroxisomal membrane protein PMP34
10	9606.ENSP00000331106	0.983	Peroxisome assembly protein 26
11	9606.ENSP00000288774	0.980	Peroxisome biogenesis factor 10
12	9606.ENSP00000379568	0.979	Acyl-CoA-binding domain-containing protein 5
13	9606.ENSP00000358312	0.977	Peroxisomal membrane protein 11B
14	9606.ENSP00000359233	0.976	ATP-binding cassette sub-family D member 3
15	9606.ENSP00000303511	0.974	Peroxisome assembly factor 2
16	9606.ENSP00000356563	0.971	Peroxisomal biogenesis factor 3
17	9606.ENSP00000248633	0.966	Peroxisome biogenesis factor 1
18	9606.ENSP00000360569	0.965	Non-specific lipid-transfer protein
19	9606.ENSP00000218104	0.960	ATP-binding cassette sub-family D member 1
20	9606.ENSP00000339017	0.951	ATPase family AAA domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0005515	1.000	protein binding
GO:0008320	0.992	protein transmembrane transporter activity
GO:0042802	0.988	identical protein binding
GO:0003714	0.977	transcription corepressor activity
GO:0048487	0.977	beta-tubulin binding
GO:0008017	0.977	microtubule binding
GO:0005102	0.892	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0015919	0.966	peroxisomal membrane transport
GO:0044743	0.965	protein transmembrane import into intracellular organelle
GO:0065002	0.965	intracellular protein transmembrane transport
GO:0016558	0.964	protein import into peroxisome matrix
GO:0065007	0.740	biological regulation
GO:0050789	0.715	regulation of biological process
GO:0050794	0.648	regulation of cellular process
GO:0019222	0.583	regulation of metabolic process
GO:0031323	0.313	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005778	0.996	peroxisomal membrane
GO:0032991	0.986	protein-containing complex
GO:0005829	0.972	cytosol
GO:0070013	0.951	intracellular organelle lumen
GO:0031981	0.634	nuclear lumen
GO:0043232	0.386	intracellular non-membrane-bounded organelle
GO:0005654	0.337	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]