StarFunc result for job id O75386

User Input

>input (442 residues)
MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRA
KPRASDEQTPLVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTAS
KPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADN
LLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARK
RKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTR
QELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVE
LHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNY
PLCAVQAFGIGLSSFDSKLACE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75386	1.000	1.000	2.510E-85	442	1.000	1.000	O75386.pdb.gz	TULP3_HUMAN Tubby-related protein 3 OS=Homo sapiens OX=9606 GN=TULP3 PE=1 SV=2
2	AFDB:O88413	0.670	0.645	8.775E-64	460	0.710	0.683	O88413.pdb.gz	TULP3_MOUSE Tubby-related protein 3 OS=Mus musculus OX=10090 GN=Tulp3 PE=1 SV=1
3	AFDB:P50607	0.713	0.625	2.485E-54	506	0.559	0.488	P50607.pdb.gz	TUB_HUMAN Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1
4	AFDB:O00295	0.590	0.502	1.096E-41	520	0.396	0.337	O00295.pdb.gz	TULP2_HUMAN Tubby-related protein 2 OS=Homo sapiens OX=9606 GN=TULP2 PE=2 SV=2
5	AFDB:Q09306	0.566	0.586	1.338E-39	426	0.403	0.418	Q09306.pdb.gz	TUB1_CAEEL Tubby protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tub-1 PE=1 SV=3
6	AFDB:A0A0B4KI44	0.175	0.055	4.214E-8	1433	0.183	0.057	A0A0B4KI44.pdb.gz	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
7	AFDB:Q5AIR7	0.091	0.046	2.702E-2	1145	0.111	0.043	Q5AIR7.pdb.gz	ENG1_CANAL Glucan endo-1,3-beta-D-glucosidase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
8	AFDB:Q66VB0	0.059	0.033	2.863E-2	1086	0.063	0.026	Q66VB0.pdb.gz	Q66VB0_ORYSJ No pollen OS=Oryza sativa subsp. japonica OX=39947 PE=2 SV=1
9	AFDB:Q20684	0.066	0.032	4.293E-2	1245	0.111	0.039	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
10	PDB:7r76A	0.082	0.028	4.685E-2	1834	0.068	0.016	7r76A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
11	AFDB:A1ZBJ8	0.102	0.091	5.411E-2	513	0.090	0.078	A1ZBJ8.pdb.gz	A1ZBJ8_DROME FI19908p1 OS=Drosophila melanogaster OX=7227 GN=fest PE=2 SV=1
12	PDB:3wjeB	0.135	0.273	6.631E-2	154	0.048	0.136	3wjeB.pdb.gz
13	PDB:2byoA	0.087	0.163	8.856E-2	183	0.036	0.087	2byoA.pdb.gz	Lppx is a Lipoprotein Required for the Translocation of Phthiocerol Dimycocerosates to the Surface of Mycobacterium Tuberculosis.
14	PDB:5lj5t	0.083	0.083	1.407E-1	438	0.050	0.050	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
15	PDB:3ve1A	0.125	0.107	1.491E-1	537	0.061	0.050	3ve1A.pdb.gz	The structural basis of transferrin sequestration by transferrin-binding protein B.
16	PDB:3ve2A	0.127	0.113	1.491E-1	514	0.070	0.060	3ve2A.pdb.gz
17	PDB:6kxkD	0.083	0.070	1.774E-1	553	0.075	0.060	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
18	PDB:6kybB	0.135	0.166	1.774E-1	330	0.052	0.070	6kybB.pdb.gz
19	PDB:7mqaLQ	0.114	0.073	1.774E-1	830	0.041	0.022	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1vmoA	0.069	0.134	1.992E-1	163	0.038	0.104	1vmoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75386	0.0	927	442	1.000	1.000	TULP3_HUMAN Tubby-related protein 3 OS=Homo sapiens OX=9606 GN=TULP3 PE=1 SV=2
2	O88413	0.0	639	460	0.724	0.696	TULP3_MOUSE Tubby-related protein 3 OS=Mus musculus OX=10090 GN=Tulp3 PE=1 SV=1
3	P50607	1.52e-146	429	506	0.486	0.425	TUB_HUMAN Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1
4	O88808	1.05e-142	419	505	0.459	0.402	TUB_RAT Tubby protein homolog OS=Rattus norvegicus OX=10116 GN=Tub PE=2 SV=1
5	P50586	5.72e-142	417	505	0.412	0.360	TUB_MOUSE Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1 SV=1
6	O00294	1.26e-129	387	542	0.387	0.315	TULP1_HUMAN Tubby-related protein 1 OS=Homo sapiens OX=9606 GN=TULP1 PE=1 SV=3
7	Q9Z273	5.57e-126	377	543	0.382	0.311	TULP1_MOUSE Tubby-related protein 1 OS=Mus musculus OX=10090 GN=Tulp1 PE=1 SV=1
8	Q86PC9	1.41e-114	345	460	0.446	0.428	TULP_DROME Protein king tubby OS=Drosophila melanogaster OX=7227 GN=ktub PE=1 SV=1
9	Q09306	1.71e-101	311	426	0.342	0.354	TUB1_CAEEL Tubby protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tub-1 PE=1 SV=3
10	O00295	1.98e-88	280	520	0.292	0.248	TULP2_HUMAN Tubby-related protein 2 OS=Homo sapiens OX=9606 GN=TULP2 PE=2 SV=2
11	Q6NPQ1	7.31e-49	173	389	0.244	0.278	TLP11_ARATH Tubby-like F-box protein 11 OS=Arabidopsis thaliana OX=3702 GN=TULP11 PE=2 SV=1
12	C0Z2Z7	1.38e-48	172	407	0.256	0.278	C0Z2Z7_ARATH AT2G47900 protein OS=Arabidopsis thaliana OX=3702 GN=TLP3 PE=1 SV=1
13	Q9FRH7	3.96e-45	164	445	0.256	0.254	TLP10_ARATH Tubby-like F-box protein 10 OS=Arabidopsis thaliana OX=3702 GN=TULP10 PE=1 SV=1
14	Q9ZP59	6.94e-45	164	455	0.260	0.253	TLP1_ARATH Tubby-like F-box protein 1 OS=Arabidopsis thaliana OX=3702 GN=TULP1 PE=1 SV=1
15	Q93VI8	5.97e-44	159	379	0.231	0.269	TLP7_ARATH Tubby-like F-box protein 7 OS=Arabidopsis thaliana OX=3702 GN=TULP7 PE=2 SV=1
16	Q944S3	1.87e-43	159	429	0.235	0.242	TLP5_ARATH Tubby-like F-box protein 5 OS=Arabidopsis thaliana OX=3702 GN=TULP5 PE=2 SV=1
17	Q9SQU1	7.77e-43	157	380	0.229	0.266	TLP9_ARATH Tubby-like F-box protein 9 OS=Arabidopsis thaliana OX=3702 GN=TULP9 PE=1 SV=1
18	Q8GVE5	1.65e-42	156	394	0.208	0.234	TLP2_ARATH Tubby-like F-box protein 2 OS=Arabidopsis thaliana OX=3702 GN=TULP2 PE=2 SV=1
19	Q0WPY0	1.67e-41	154	413	0.226	0.242	TLP6_ARATH Tubby-like F-box protein 6 OS=Arabidopsis thaliana OX=3702 GN=TULP6 PE=2 SV=1
20	A0A0B4KI44	3.18e-17	87.0	1433	0.088	0.027	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01167 Tub	1.5e-87	305.2	Tub family
2	PF16322 Tub_N	2.6e-20	85.1	Tubby N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243344	0.944	Tetratricopeptide repeat protein 21B
2	9606.ENSP00000441039	0.940	G-protein coupled receptor 161
3	9606.ENSP00000314444	0.935	WD repeat-containing protein 35
4	9606.ENSP00000296266	0.934	Intraflagellar transport protein 122 homolog
5	9606.ENSP00000382717	0.934	WD repeat-containing protein 19
6	9606.ENSP00000406012	0.930	Intraflagellar transport protein 140 homolog
7	9606.ENSP00000238628	0.784	Intraflagellar transport proteins
8	9606.ENSP00000215941	0.739	Ankyrin repeat domain-containing protein 54
9	9606.ENSP00000286548	0.736	Guanine nucleotide-binding protein G(q) subunit alpha
10	9606.ENSP00000417610	0.726	Ras-related protein Rab-23
11	9606.ENSP00000359719	0.697	cAMP-dependent protein kinase catalytic subunit beta
12	9606.ENSP00000338769	0.687	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3
13	9606.ENSP00000376475	0.681	cAMP-dependent protein kinase type I-alpha regulatory subunit
14	9606.ENSP00000309591	0.679	cAMP-dependent protein kinase catalytic subunit alpha
15	9606.ENSP00000366488	0.679	cAMP-dependent protein kinase catalytic subunit gamma
16	9606.ENSP00000476767	0.677	Peptidyl-prolyl cis-trans isomerase FKBP8
17	9606.ENSP00000480971	0.673	Somatostatin receptor type 3
18	9606.ENSP00000480637	0.661	Melanoma-associated antigen 6
19	9606.ENSP00000265563	0.658	cAMP-dependent protein kinase type II-alpha regulatory subunit
20	9606.ENSP00000265717	0.658	cAMP-dependent protein kinase type II-beta regulatory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0019899	1.000	enzyme binding
GO:0035091	1.000	phosphatidylinositol binding
GO:0001664	1.000	G protein-coupled receptor binding
GO:0120160	0.751	intraciliary transport particle A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0061512	0.926	protein localization to cilium
GO:0009966	0.887	regulation of signal transduction
GO:0048523	0.808	negative regulation of cellular process
GO:0008589	0.754	regulation of smoothened signaling pathway
GO:0008277	0.699	regulation of G protein-coupled receptor signaling pathway
GO:0023057	0.625	negative regulation of signaling
GO:0010648	0.625	negative regulation of cell communication
GO:0009968	0.605	negative regulation of signal transduction
GO:0045879	0.325	negative regulation of smoothened signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005929	0.999	cilium
GO:0031981	0.990	nuclear lumen
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0016020	0.968	membrane
GO:0005886	0.963	plasma membrane
GO:0005737	0.954	cytoplasm
GO:0005654	0.910	nucleoplasm
GO:0097546	0.759	ciliary base
GO:0097730	0.734	non-motile cilium
GO:0097731	0.694	9+0 non-motile cilium
GO:0005829	0.664	cytosol
GO:0005730	0.421	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]