StarFunc result for job id O75396

User Input

>input (215 residues)
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCDLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSCARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMHSTYAKLAAVAVFFIMLIVYVRFWWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08547	0.776	0.776	4.863E-35	215	0.981	0.981	O08547.pdb.gz	SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus OX=10090 GN=Sec22b PE=1 SV=3
2	AFDB:M9PGI6	0.742	0.749	4.645E-23	213	0.567	0.573	M9PGI6.pdb.gz	M9PGI6_DROME Secretory 22, isoform B OS=Drosophila melanogaster OX=7227 GN=Sec22 PE=1 SV=1
3	PDB:2nupC	0.598	0.933	2.328E-21	137	0.600	0.942	2nupC.pdb.gz	The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
4	AFDB:Q55CR0	0.714	0.717	3.967E-18	214	0.381	0.383	Q55CR0.pdb.gz	Q55CR0_DICDI Vesicle-trafficking protein SEC22b OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269942 PE=3 SV=1
5	AFDB:Q94AU2	0.704	0.695	4.741E-18	218	0.456	0.450	Q94AU2.pdb.gz	SC221_ARATH 25.3 kDa vesicle transport protein SEC22-1 OS=Arabidopsis thaliana OX=3702 GN=SEC221 PE=1 SV=1
6	AFDB:P22214	0.714	0.717	1.582E-16	214	0.377	0.379	P22214.pdb.gz	SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC22 PE=1 SV=1
7	AFDB:O97323	0.664	0.648	1.782E-16	221	0.307	0.299	O97323.pdb.gz	O97323_PLAF7 Protein transport protein SEC22 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320100 PE=3 SV=2
8	AFDB:Q388Z8	0.664	0.696	3.985E-14	205	0.251	0.263	Q388Z8.pdb.gz	Q388Z8_TRYB2 Longin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1260 PE=3 SV=1
9	AFDB:Q642F4	0.624	0.444	2.371E-13	307	0.279	0.195	Q642F4.pdb.gz	SC22A_RAT Vesicle-trafficking protein SEC22a OS=Rattus norvegicus OX=10116 GN=Sec22a PE=2 SV=1
10	AFDB:Q9BRL7	0.611	0.443	2.598E-11	303	0.223	0.158	Q9BRL7.pdb.gz	SC22C_HUMAN Vesicle-trafficking protein SEC22c OS=Homo sapiens OX=9606 GN=SEC22C PE=1 SV=1
11	AFDB:Q9FMR5	0.602	0.586	2.082E-10	221	0.191	0.186	Q9FMR5.pdb.gz	VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana OX=3702 GN=VAMP714 PE=1 SV=1
12	PDB:6j7fC	0.520	0.567	3.333E-6	195	0.149	0.164	6j7fC.pdb.gz	Complex of GGTaseIII, farnesyl-Ykt6 (C-terminal methylated), and GGPP
13	PDB:7p3xS	0.404	0.501	1.130E-3	168	0.084	0.107	7p3xS.pdb.gz
14	PDB:2jkrS	0.340	0.488	1.433E-3	142	0.112	0.169	2jkrS.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
15	PDB:1w63Q	0.343	0.474	1.929E-3	148	0.093	0.135	1w63Q.pdb.gz
16	PDB:4hmyS	0.349	0.491	2.173E-3	145	0.037	0.055	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
17	PDB:4ftxA	0.302	0.392	2.597E-3	158	0.065	0.089	4ftxA.pdb.gz
18	PDB:2j3tC	0.351	0.503	2.756E-3	141	0.070	0.106	2j3tC.pdb.gz
19	PDB:7rwaM	0.344	0.206	2.925E-3	379	0.056	0.032	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
20	PDB:4xpmB	0.231	0.665	3.104E-3	67	0.037	0.119	4xpmB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08547	1.54e-157	436	215	0.981	0.981	SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus OX=10090 GN=Sec22b PE=1 SV=3
2	O75396	1.54e-157	436	215	0.981	0.981	SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=5
3	Q4KM74	1.54e-157	436	215	0.981	0.981	SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus OX=10116 GN=Sec22b PE=1 SV=3
4	M9PGI6	7.55e-83	247	213	0.563	0.568	M9PGI6_DROME Secretory 22, isoform B OS=Drosophila melanogaster OX=7227 GN=Sec22 PE=1 SV=1
5	Q94AU2	8.35e-60	189	218	0.460	0.454	SC221_ARATH 25.3 kDa vesicle transport protein SEC22-1 OS=Arabidopsis thaliana OX=3702 GN=SEC221 PE=1 SV=1
6	P22214	3.27e-46	154	214	0.386	0.388	SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC22 PE=1 SV=1
7	Q55CR0	1.92e-44	149	214	0.386	0.388	Q55CR0_DICDI Vesicle-trafficking protein SEC22b OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269942 PE=3 SV=1
8	Q96IW7	6.62e-25	101	307	0.270	0.189	SC22A_HUMAN Vesicle-trafficking protein SEC22a OS=Homo sapiens OX=9606 GN=SEC22A PE=1 SV=1
9	Q642F4	4.28e-24	99.0	307	0.279	0.195	SC22A_RAT Vesicle-trafficking protein SEC22a OS=Rattus norvegicus OX=10116 GN=Sec22a PE=2 SV=1
10	O97323	7.51e-24	96.7	221	0.274	0.267	O97323_PLAF7 Protein transport protein SEC22 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320100 PE=3 SV=2
11	Q388Z8	2.76e-19	84.0	205	0.302	0.317	Q388Z8_TRYB2 Longin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1260 PE=3 SV=1
12	Q9BRL7	2.11e-13	69.7	303	0.191	0.135	SC22C_HUMAN Vesicle-trafficking protein SEC22c OS=Homo sapiens OX=9606 GN=SEC22C PE=1 SV=1
13	Q9LFP1	1.66e-12	66.2	221	0.209	0.204	VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana OX=3702 GN=VAMP713 PE=1 SV=1
14	O49377	7.79e-12	64.3	219	0.181	0.178	VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana OX=3702 GN=VAMP711 PE=1 SV=2
15	Q9FMR5	5.48e-11	62.0	221	0.191	0.186	VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana OX=3702 GN=VAMP714 PE=1 SV=1
16	Q9SIQ9	1.45e-10	60.8	219	0.158	0.155	VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana OX=3702 GN=VAMP712 PE=2 SV=1
17	O48850	1.20e-09	58.9	285	0.181	0.137	VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana OX=3702 GN=VAMP725 PE=2 SV=2
18	Q7JYX5	3.19e-09	57.0	218	0.191	0.188	Q7JYX5_DROME RH15778p OS=Drosophila melanogaster OX=7227 GN=Vamp7 PE=1 SV=1
19	Q9ZTW3	1.87e-08	54.7	219	0.177	0.174	VA721_ARATH Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana OX=3702 GN=VAMP721 PE=2 SV=1
20	B2R6P4	2.30e-08	54.7	220	0.177	0.173	B2R6P4_HUMAN cDNA, FLJ93048, highly similar to Homo sapiens synaptobrevin-like 1 (SYBL1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13774 Longin	1.7e-20	84.2	Regulated-SNARE-like domain
2	PF03908 Sec20	4.1e+02	12.3	Sec20
3	PF00957 Synaptobrevin	2.2e-12	57.9	Synaptobrevin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008828741.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008835716.1	0.999	Syntaxin-5 isoform X1
2	1026970.XP_008831338.1	0.995	Syntaxin-18
3	1026970.XP_008820780.1	0.994	Bet1 golgi vesicular membrane trafficking protein
4	1026970.XP_008820140.1	0.993	Golgi SNAP receptor complex member 2 isoform X1
5	1026970.XP_008824526.1	0.993	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 538 bases not found in genome assembly
6	1026970.XP_008842337.1	0.993	Golgi SNAP receptor complex member 2-like
7	1026970.XP_008848996.1	0.992	BCL2 interacting protein 1
8	1026970.XP_008822851.1	0.991	Unconventional SNARE in the ER 1
9	1026970.XP_008820416.1	0.984	Alpha-soluble NSF attachment protein isoform X1
10	1026970.XP_008832302.1	0.983	YKT6 v-SNARE homolog (S. cerevisiae)
11	1026970.XP_008826961.1	0.982	Golgi SNAP receptor complex member 1 isoform X1
12	1026970.XP_008846609.1	0.981	syntaxin-1A
13	1026970.XP_008822035.1	0.977	Syntaxin 4
14	1026970.XP_008837018.1	0.973	Sec1 family domain-containing protein 1
15	1026970.XP_008835143.1	0.971	Beta-soluble NSF attachment protein
16	1026970.XP_008852577.1	0.970	Bet1 golgi vesicular membrane trafficking protein like
17	1026970.XP_008822043.1	0.966	syntaxin-1B
18	1026970.XP_008850381.1	0.964	Vesicle transport through interaction with t-SNAREs 1B
19	1026970.XP_008825411.1	0.960	Synaptosome associated protein 25
20	1026970.XP_008838498.1	0.957	Vesicle-associated membrane protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051234	0.995	establishment of localization
GO:0016192	0.994	vesicle-mediated transport
GO:0051649	0.986	establishment of localization in cell
GO:0048193	0.981	Golgi vesicle transport
GO:0006888	0.970	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0065007	0.539	biological regulation
GO:0050789	0.479	regulation of biological process
GO:0050794	0.413	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.998	organelle membrane
GO:0005794	0.994	Golgi apparatus
GO:0031410	0.991	cytoplasmic vesicle
GO:0098588	0.984	bounding membrane of organelle
GO:0005783	0.983	endoplasmic reticulum
GO:0032991	0.977	protein-containing complex
GO:0031984	0.977	organelle subcompartment
GO:0098827	0.974	endoplasmic reticulum subcompartment
GO:0030659	0.972	cytoplasmic vesicle membrane
GO:0042175	0.971	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0030133	0.965	transport vesicle
GO:0005789	0.964	endoplasmic reticulum membrane
GO:0030135	0.933	coated vesicle
GO:0000139	0.924	Golgi membrane
GO:0098796	0.836	membrane protein complex
GO:0030054	0.793	cell junction
GO:0030658	0.751	transport vesicle membrane
GO:0005793	0.736	endoplasmic reticulum-Golgi intermediate compartment
GO:0033116	0.675	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0031201	0.609	SNARE complex
GO:0030662	0.549	coated vesicle membrane
GO:0030139	0.417	endocytic vesicle
GO:0030134	0.412	COPII-coated ER to Golgi transport vesicle
GO:0071944	0.392	cell periphery
GO:0005886	0.366	plasma membrane
GO:0045202	0.318	synapse
GO:0045335	0.304	phagocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]