StarFunc result for job id O75398

User Input

>input (565 residues)
MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERET
PRVTAVAVMAAEPGHMDMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVAN
AASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTP
LAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTEF
EAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPY
KRRKKENELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFDRASTVEATAV
ISESPAQGDVFAGATVQEASVQPPCRASHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVL
TSLPALAVPPPTPTKAAPPALVNGLELSEPRSWLYLEEMVNSLLNTAQQLKTLFEQAKHA
STYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHIC
GQSAAVTVQADEVHVAESVMEKVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1T5	0.340	0.340	1.815E-76	566	0.936	0.935	Q9Z1T5.pdb.gz	DEAF1_MOUSE Deformed epidermal autoregulatory factor 1 homolog OS=Mus musculus OX=10090 GN=Deaf1 PE=1 SV=1
2	AFDB:Q24180	0.192	0.189	4.708E-28	576	0.246	0.241	Q24180.pdb.gz	DEAF1_DROME Deformed epidermal autoregulatory factor 1 OS=Drosophila melanogaster OX=7227 GN=Deaf1 PE=1 SV=1
3	PDB:5v3hA	0.069	0.089	9.808E-3	438	0.025	0.032	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
4	AFDB:Q659C4	0.073	0.052	3.871E-2	914	0.127	0.079	Q659C4.pdb.gz	LAR1B_HUMAN La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B PE=1 SV=2
5	AFDB:O13862	0.062	0.071	6.949E-2	478	0.110	0.130	O13862.pdb.gz	RDP1L_SCHPO Transcriptional activator protein rdp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rdp1 PE=4 SV=1
6	AFDB:Q57Y22	0.071	0.052	9.012E-2	832	0.145	0.099	Q57Y22.pdb.gz	Q57Y22_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.350 PE=4 SV=1
7	PDB:3n71A	0.067	0.081	9.541E-2	468	0.019	0.024	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
8	PDB:5ex0A	0.067	0.088	1.160E-1	429	0.028	0.037	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
9	AFDB:O60307	0.056	0.033	1.169E-1	1309	0.133	0.057	O60307.pdb.gz	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
10	AFDB:Q12215	0.067	0.068	1.516E-1	556	0.101	0.103	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
11	AFDB:Q56UE1	0.098	0.087	2.550E-1	643	0.158	0.138	Q56UE1.pdb.gz	Q56UE1_EMEND NSDC OS=Emericella nidulans OX=162425 GN=nsdC PE=4 SV=1
12	AFDB:Q8IGV4	0.121	0.072	4.289E-1	1002	0.119	0.067	Q8IGV4.pdb.gz	Q8IGV4_DROME RE23622p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
13	AFDB:Q9V5M6	0.065	0.044	4.577E-1	963	0.143	0.084	Q9V5M6.pdb.gz	LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=4
14	PDB:6gejS	0.051	0.135	1.666	208	0.016	0.043	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:2xjeA	0.078	0.091	2.306	465	0.016	0.019	2xjeA.pdb.gz	Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
16	PDB:4ohfB	0.078	0.092	2.803	458	0.014	0.017	4ohfB.pdb.gz	Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
17	PDB:1k6zA	0.029	0.131	3.879	122	0.002	0.008	1k6zA.pdb.gz
18	PDB:1oc4A	0.037	0.065	3.879	315	0.014	0.025	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
19	PDB:7qsmZ	0.096	0.313	5.031	142	0.019	0.077	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
20	PDB:8dfvA	0.060	0.026	5.369	1664	0.011	0.004	8dfvA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75398	0.0	1158	565	1.000	1.000	DEAF1_HUMAN Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1 PE=1 SV=1
2	O88450	0.0	986	565	0.938	0.938	DEAF1_RAT Deformed epidermal autoregulatory factor 1 homolog OS=Rattus norvegicus OX=10116 GN=Deaf1 PE=1 SV=1
3	Q9Z1T5	0.0	981	566	0.933	0.931	DEAF1_MOUSE Deformed epidermal autoregulatory factor 1 homolog OS=Mus musculus OX=10090 GN=Deaf1 PE=1 SV=1
4	Q24180	8.13e-38	149	576	0.112	0.109	DEAF1_DROME Deformed epidermal autoregulatory factor 1 OS=Drosophila melanogaster OX=7227 GN=Deaf1 PE=1 SV=1
5	W8FW32	4.79e-14	77.4	567	0.060	0.060	W8FW32_HUMAN CBFA2T1 isoform r1t1-7d56 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=2 SV=1
6	Q61909	5.57e-14	77.0	577	0.060	0.059	MTG8_MOUSE Protein CBFA2T1 OS=Mus musculus OX=10090 GN=Runx1t1 PE=2 SV=1
7	A0A0A0MSU1	6.58e-14	77.0	663	0.060	0.051	A0A0A0MSU1_HUMAN RUNX1 partner transcriptional co-repressor 1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=1
8	Q06455	6.78e-14	77.0	604	0.060	0.056	MTG8_HUMAN Protein CBFA2T1 OS=Homo sapiens OX=9606 GN=RUNX1T1 PE=1 SV=2
9	O54972	1.97e-12	72.4	620	0.064	0.058	MTG16_MOUSE Protein CBFA2T3 OS=Mus musculus OX=10090 GN=Cbfa2t3 PE=1 SV=2
10	O75081	2.16e-12	72.0	653	0.062	0.054	MTG16_HUMAN Protein CBFA2T3 OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=2
11	P23497	3.61e-12	71.6	879	0.057	0.036	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
12	Q9IAB2	6.93e-12	70.5	586	0.050	0.048	MTG8R_XENLA Protein CBFA2T2 OS=Xenopus laevis OX=8355 GN=cbfa2t2 PE=2 SV=2
13	Q24037	9.19e-12	70.5	743	0.057	0.043	Q24037_DROME Nervy OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=1
14	Q9W186	1.11e-11	70.1	743	0.057	0.043	Q9W186_DROME LD17501p OS=Drosophila melanogaster OX=7227 GN=nvy PE=2 SV=2
15	A0A0B4KFZ8	1.19e-11	70.1	742	0.057	0.043	A0A0B4KFZ8_DROME Nervy, isoform B OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
16	A0A0B4KEZ2	1.36e-11	69.7	757	0.057	0.042	A0A0B4KEZ2_DROME Nervy, isoform D OS=Drosophila melanogaster OX=7227 GN=nvy PE=4 SV=1
17	O70374	2.07e-11	68.9	594	0.048	0.045	MTG8R_MOUSE Protein CBFA2T2 OS=Mus musculus OX=10090 GN=Cbfa2t2 PE=1 SV=3
18	O43439	4.17e-11	68.2	604	0.046	0.043	MTG8R_HUMAN Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2 PE=1 SV=1
19	Q13342	9.50e-11	67.0	867	0.053	0.035	SP140_HUMAN Nuclear body protein SP140 OS=Homo sapiens OX=9606 GN=SP140 PE=1 SV=2
20	Q8BVK9	7.99e-09	60.5	445	0.053	0.067	SP110_MOUSE Sp110 nuclear body protein OS=Mus musculus OX=10090 GN=Sp110 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01342 SAND	9e-23	91.2	SAND domain
2	PF01753 zf-MYND	9.4e-06	36.9	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381053	0.825	Zinc finger MYND domain-containing protein 11
2	9606.ENSP00000298585	0.824	Zinc finger MYND domain-containing protein 19
3	9606.ENSP00000352257	0.787	X-ray repair cross-complementing protein 6
4	9606.ENSP00000351118	0.746	Cadherin-related family member 5
5	9606.ENSP00000321691	0.710	Glutamine amidotransferase-like class 1 domain-containing protein 1
6	9606.ENSP00000291582	0.708	Autoimmune regulator
7	9606.ENSP00000304923	0.692	Leucine-rich repeat-containing protein 28
8	9606.ENSP00000176183	0.688	Dopamine receptor D4
9	9606.ENSP00000313601	0.668	Coiled-coil and C2 domain-containing protein 1A
10	9606.ENSP00000249016	0.667	Melanin-concentrating hormone receptor 1
11	9606.ENSP00000435585	0.664	Epidermal growth factor receptor kinase substrate 8-like protein 2
12	9606.ENSP00000355924	0.658	N-lysine methyltransferase SMYD2
13	9606.ENSP00000411831	0.655	Kinesin-like protein KIF21B
14	9606.ENSP00000393453	0.653	Histone-lysine N-methyltransferase SMYD1
15	9606.ENSP00000316244	0.652	5-hydroxytryptamine receptor 1A
16	9606.ENSP00000359664	0.651	Di-N-acetylchitobiase
17	9606.ENSP00000356124	0.645	Kelch domain containing 8A
18	9606.ENSP00000383274	0.640	Eukaryotic translation initiation factor 4 gamma 3
19	9606.ENSP00000448035	0.639	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
20	9606.ENSP00000392466	0.632	LIM domain-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0001067	0.666	transcription regulatory region nucleic acid binding
GO:0001217	0.658	DNA-binding transcription repressor activity
GO:0000977	0.600	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0006357	0.962	regulation of transcription by RNA polymerase II
GO:0045935	0.960	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.946	positive regulation of DNA-templated transcription
GO:0009987	0.749	cellular process
GO:0048519	0.502	negative regulation of biological process
GO:0048523	0.493	negative regulation of cellular process
GO:0008152	0.420	metabolic process
GO:0071704	0.413	organic substance metabolic process
GO:0050896	0.404	response to stimulus
GO:0044238	0.398	primary metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:0044237	0.353	cellular metabolic process
GO:0043170	0.348	macromolecule metabolic process
GO:0010605	0.333	negative regulation of macromolecule metabolic process
GO:0031324	0.324	negative regulation of cellular metabolic process
GO:0051172	0.323	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0043228	0.977	non-membrane-bounded organelle
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0032991	0.939	protein-containing complex
GO:0140513	0.639	nuclear protein-containing complex
GO:0005667	0.630	transcription regulator complex
GO:0090575	0.563	RNA polymerase II transcription regulator complex
GO:0005730	0.483	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]