StarFunc result for job id O75414

User Input

>input (186 residues)
MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFY
REHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGT
GGLGPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75414	1.000	1.000	1.744E-38	186	1.000	1.000	O75414.pdb.gz	NDK6_HUMAN Nucleoside diphosphate kinase 6 OS=Homo sapiens OX=9606 GN=NME6 PE=1 SV=3
2	AFDB:O88425	0.925	0.911	2.714E-34	189	0.892	0.878	O88425.pdb.gz	NDK6_MOUSE Nucleoside diphosphate kinase 6 OS=Mus musculus OX=10090 GN=Nme6 PE=1 SV=1
3	AFDB:P56597	0.731	0.642	6.369E-16	212	0.328	0.288	P56597.pdb.gz	NDK5_HUMAN Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens OX=9606 GN=NME5 PE=1 SV=1
4	AFDB:Q99MH5	0.727	0.642	2.316E-15	211	0.323	0.284	Q99MH5.pdb.gz	NDK5_MOUSE Nucleoside diphosphate kinase homolog 5 OS=Mus musculus OX=10090 GN=Nme5 PE=1 SV=2
5	AFDB:P0A763	0.692	0.893	2.881E-14	143	0.301	0.392	P0A763.pdb.gz	NDK_ECOLI Nucleoside diphosphate kinase OS=Escherichia coli (strain K12) OX=83333 GN=ndk PE=1 SV=2
6	AFDB:Q5E9Y9	0.704	0.350	6.407E-14	377	0.263	0.130	Q5E9Y9.pdb.gz	NDK7_BOVIN Nucleoside diphosphate kinase 7 OS=Bos taurus OX=9913 GN=NME7 PE=1 SV=1
7	PDB:2hurA	0.685	0.889	7.354E-14	142	0.301	0.394	2hurA.pdb.gz
8	AFDB:A8JGW5	0.702	0.346	7.705E-14	380	0.285	0.139	A8JGW5.pdb.gz	A8JGW5_CHLRE Nucleoside diphosphate kinase OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_12g558700v5 PE=1 SV=1
9	AFDB:Q6IRC5	0.743	0.230	9.853E-14	625	0.296	0.088	Q6IRC5.pdb.gz	TXND6_XENLA Thioredoxin domain-containing protein 6 OS=Xenopus laevis OX=8355 GN=nme9 PE=2 SV=1
10	AFDB:Q9QXL8	0.700	0.332	1.340E-13	395	0.280	0.132	Q9QXL8.pdb.gz	NDK7_MOUSE Nucleoside diphosphate kinase 7 OS=Mus musculus OX=10090 GN=Nme7 PE=1 SV=1
11	AFDB:P36010	0.681	0.820	2.980E-13	153	0.280	0.340	P36010.pdb.gz	NDK_YEAST Nucleoside diphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNK1 PE=1 SV=1
12	PDB:4cp5A	0.674	0.822	1.100E-12	151	0.269	0.331	4cp5A.pdb.gz	Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
13	PDB:1vyaA	0.673	0.832	1.591E-12	149	0.247	0.309	1vyaA.pdb.gz
14	PDB:1zs6A	0.684	0.831	2.034E-12	152	0.274	0.336	1zs6A.pdb.gz	Structure of human nucleoside-diphosphate kinase 3
15	PDB:3wx8A	0.669	0.804	2.034E-12	153	0.226	0.275	3wx8A.pdb.gz
16	PDB:3l7uB	0.666	0.796	2.446E-12	154	0.242	0.292	3l7uB.pdb.gz
17	PDB:1u8wA	0.671	0.830	5.440E-12	149	0.253	0.315	1u8wA.pdb.gz
18	PDB:7kpfA	0.676	0.820	6.957E-12	152	0.247	0.303	7kpfA.pdb.gz	A Chemical Proteomic Approach reveals the regulation of NME1/2 and cancer metastasis by Long-Chain Fatty Acyl Coenzyme A
19	PDB:6u425O	0.698	0.352	1.006E-11	376	0.290	0.144	6u425O.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
20	PDB:4fkxA	0.671	0.810	1.138E-11	153	0.231	0.281	4fkxA.pdb.gz	Crystal structure of nucleoside diphosphate kinase B from Trypanosoma brucei bound to CDP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75414	9.11e-139	386	186	1.000	1.000	NDK6_HUMAN Nucleoside diphosphate kinase 6 OS=Homo sapiens OX=9606 GN=NME6 PE=1 SV=3
2	O88425	1.90e-122	345	189	0.892	0.878	NDK6_MOUSE Nucleoside diphosphate kinase 6 OS=Mus musculus OX=10090 GN=Nme6 PE=1 SV=1
3	Q99MH5	1.94e-29	109	211	0.296	0.261	NDK5_MOUSE Nucleoside diphosphate kinase homolog 5 OS=Mus musculus OX=10090 GN=Nme5 PE=1 SV=2
4	P56597	5.99e-29	108	212	0.301	0.264	NDK5_HUMAN Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens OX=9606 GN=NME5 PE=1 SV=1
5	Q9QXL8	1.63e-24	100	395	0.285	0.134	NDK7_MOUSE Nucleoside diphosphate kinase 7 OS=Mus musculus OX=10090 GN=Nme7 PE=1 SV=1
6	Q6IRC5	2.82e-24	100	625	0.285	0.085	TXND6_XENLA Thioredoxin domain-containing protein 6 OS=Xenopus laevis OX=8355 GN=nme9 PE=2 SV=1
7	P0A763	1.24e-23	92.8	143	0.296	0.385	NDK_ECOLI Nucleoside diphosphate kinase OS=Escherichia coli (strain K12) OX=83333 GN=ndk PE=1 SV=2
8	Q9Y5B8	1.48e-23	97.8	376	0.274	0.136	NDK7_HUMAN Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7 PE=1 SV=1
9	Q5E9Y9	8.78e-23	95.5	377	0.269	0.133	NDK7_BOVIN Nucleoside diphosphate kinase 7 OS=Bos taurus OX=9913 GN=NME7 PE=1 SV=1
10	Q59636	3.24e-22	89.4	143	0.290	0.378	NDK_PSEAE Nucleoside diphosphate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ndk PE=1 SV=2
11	P22887	4.45e-22	89.4	155	0.274	0.329	NDKC_DICDI Nucleoside diphosphate kinase, cytosolic OS=Dictyostelium discoideum OX=44689 GN=ndkC-1 PE=1 SV=1
12	A8JGW5	8.90e-22	92.8	380	0.285	0.139	A8JGW5_CHLRE Nucleoside diphosphate kinase OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_12g558700v5 PE=1 SV=1
13	P9WJH7	1.88e-21	87.0	136	0.296	0.404	NDK_MYCTU Nucleoside diphosphate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndkA PE=1 SV=1
14	P49740	4.46e-21	86.7	151	0.263	0.325	NDK_SCHPO Nucleoside diphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ndk1 PE=3 SV=1
15	P36010	6.70e-20	83.6	153	0.274	0.333	NDK_YEAST Nucleoside diphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNK1 PE=1 SV=1
16	Q8N427	1.18e-18	84.7	588	0.242	0.077	TXND3_HUMAN Thioredoxin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NME8 PE=2 SV=2
17	P39207	1.02e-17	77.8	149	0.237	0.295	NDK1_ARATH Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana OX=3702 GN=NDK1 PE=1 SV=1
18	B4FK49	2.28e-17	77.0	149	0.237	0.295	NDK1_MAIZE Nucleoside diphosphate kinase 1 OS=Zea mays OX=4577 GN=ndpk1 PE=1 SV=1
19	Q93576	4.98e-17	75.9	153	0.247	0.301	Q93576_CAEEL Nucleoside diphosphate kinase OS=Caenorhabditis elegans OX=6239 GN=ndk-1 PE=1 SV=1
20	Q13232	1.10e-16	75.5	169	0.269	0.296	NDK3_HUMAN Nucleoside diphosphate kinase 3 OS=Homo sapiens OX=9606 GN=NME3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00334 NDK	3e-34	129.3	Nucleoside diphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304802	0.943	Thymidylate kinase
2	9606.ENSP00000360939	0.942	UMP-CMP kinase
3	9606.ENSP00000346577	0.938	Adenylate kinase isoenzyme 5
4	9606.ENSP00000370376	0.938	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
5	9606.ENSP00000361704	0.933	CTP synthase 1
6	9606.ENSP00000369456	0.933	Inosine triphosphate pyrophosphatase
7	9606.ENSP00000371230	0.930	GTP:AMP phosphotransferase AK3, mitochondrial
8	9606.ENSP00000368455	0.925	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
9	9606.ENSP00000251810	0.924	Ribonucleoside-diphosphate reductase subunit M2 B
10	9606.ENSP00000355689	0.921	Guanylate kinase
11	9606.ENSP00000377814	0.921	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
12	9606.ENSP00000256722	0.919	UMP-CMP kinase 2, mitochondrial
13	9606.ENSP00000300738	0.919	Ribonucleoside-diphosphate reductase large subunit
14	9606.ENSP00000401264	0.912	CTP synthase 2
15	9606.ENSP00000353770	0.909	Ribonucleoside-diphosphate reductase subunit M2
16	9606.ENSP00000355587	0.903	Cancer-related nucleoside-triphosphatase
17	9606.ENSP00000322524	0.902	dCTP pyrophosphatase 1
18	9606.ENSP00000347213	0.902	Ectonucleoside triphosphate diphosphohydrolase 2
19	9606.ENSP00000422375	0.900	U8 snoRNA-decapping enzyme
20	9606.ENSP00000410186	0.895	Adenylate kinase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004550	1.000	nucleoside diphosphate kinase activity
GO:0043167	0.572	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0050794	0.952	regulation of cellular process
GO:0009987	0.896	cellular process
GO:0008152	0.820	metabolic process
GO:0071704	0.802	organic substance metabolic process
GO:0044237	0.792	cellular metabolic process
GO:0048519	0.790	negative regulation of biological process
GO:0044238	0.761	primary metabolic process
GO:0006807	0.752	nitrogen compound metabolic process
GO:0048523	0.718	negative regulation of cellular process
GO:0051128	0.653	regulation of cellular component organization
GO:1901360	0.578	organic cyclic compound metabolic process
GO:0006725	0.573	cellular aromatic compound metabolic process
GO:0007088	0.568	regulation of mitotic nuclear division
GO:0045926	0.566	negative regulation of growth
GO:0030308	0.564	negative regulation of cell growth
GO:0046483	0.561	heterocycle metabolic process
GO:0034641	0.561	cellular nitrogen compound metabolic process
GO:0010948	0.558	negative regulation of cell cycle process
GO:0045930	0.557	negative regulation of mitotic cell cycle
GO:0051784	0.557	negative regulation of nuclear division
GO:0044281	0.509	small molecule metabolic process
GO:0006139	0.488	nucleobase-containing compound metabolic process
GO:0045839	0.448	negative regulation of mitotic nuclear division
GO:1901564	0.416	organonitrogen compound metabolic process
GO:0055086	0.375	nucleobase-containing small molecule metabolic process
GO:1901135	0.327	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005829	0.308	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.6	1.000	nucleoside-diphosphate kinase.

[back to server]