StarFunc result for job id O75420

User Input

>input (1035 residues)
MAAETLNFGPEWLRALSGGGSVASPPPSPAMPKYKLADYRYGREEMLALYVKENKVPEEL
QDKEFAAVLQDEPLQPLALEPLTEEEQRNFSLSVNSVAVLRLMGKGAGPPLAGTSRGRGS
TRSRGRGRGDSCFYQRSIEEGDGAFGRSPREIQRSQSWDDRGERRFEKSARRDGARCGFE
EGGAGPRKEHARSDSENWRSLREEQEEEEEGSWRLGAGPRRDGDRWRSASPDGGPRSAGW
REHGERRRKFEFDLRGDRGGCGEEEGRGGGGSSHLRRCRAPEGFEEDKDGLPEWCLDDED
EEMGTFDASGAFLPLKKGPKEPIPEEQELDFQGLEEEEEPSEGLEEEGPEAGGKELTPLP
PQEEKSSSPSPLPTLGPLWGTNGDGDETAEKEPPAAEDDIRGIQLSPGVGSSAGPPGDLE
DDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYK
DPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRVPFAPGPSPP
PLLGNMDQERLKKQQELAAAALYQQLQHQQFLQLVSSRQLPQCALREKAALGDLTPPPPP
PPQQQQQQLTAFLQQLQALKPPRGGDQNLLPTMSRSLSVPDSGRLWDVHTSASSQSGGEA
SLWDIPINSSTQGPILEQLQLQHKFQERREVELRAKREEEERKRREEKRRQQQQEEQKRR
QEEEELFRRKHVRQQELLLKLLQQQQAVPVPPAPSSPPPLWAGLAKQGLSMKTLLELQLE
GERQLHKQPPPREPARAQAPNHRVQLGGLGTAPLNQWVSEAGPLWGGPDKSGGGSSGLGL
WEDTPKSGGSLVRGLGLKNSRSSPSLSDSYSHLSGRPIRKKTEEEEKLLKLLQGIPRPQD
GFTQWCEQMLHTLSATGSLDVPMAVAILKEVESPYDVHDYIRSCLGDTLEAKEFAKQFLE
RRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGY
SLHGSSGEIESVDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99MR1	0.310	0.308	0.000	1044	0.916	0.908	Q99MR1.pdb.gz	GGYF1_MOUSE GRB10-interacting GYF protein 1 OS=Mus musculus OX=10090 GN=Gigyf1 PE=1 SV=2
2	AFDB:Q6Y7W6	0.122	0.102	1.132E-74	1299	0.542	0.432	Q6Y7W6.pdb.gz	GGYF2_HUMAN GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
3	AFDB:C9JHW1	0.099	0.132	2.563E-48	720	0.369	0.531	C9JHW1.pdb.gz	C9JHW1_HUMAN GRB10 interacting GYF protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
4	AFDB:Q7KQM6	0.093	0.069	2.478E-26	1574	0.290	0.191	Q7KQM6.pdb.gz	GGYF1_DROME GIGYF family protein Gyf OS=Drosophila melanogaster OX=7227 GN=Gyf PE=1 SV=2
5	AFDB:B1AR10	0.039	0.037	6.105E-6	1109	0.170	0.159	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
6	AFDB:Q8SY33	0.042	0.034	1.356E-4	1384	0.115	0.086	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
7	AFDB:A0A0K3AU72	0.109	0.074	2.112E-4	1698	0.146	0.089	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
8	AFDB:Q10728	0.054	0.054	2.112E-4	1032	0.121	0.121	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
9	AFDB:D3YXK2	0.063	0.068	2.397E-4	937	0.139	0.154	D3YXK2.pdb.gz	SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus OX=10090 GN=Safb PE=1 SV=2
10	AFDB:Q90623	0.053	0.054	2.397E-4	1004	0.112	0.116	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
11	PDB:5n9jE	0.057	0.225	8.722E-1	201	0.030	0.154	5n9jE.pdb.gz
12	PDB:3j79b	0.038	0.315	1.123	95	0.010	0.105	3j79b.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:6tedR	0.048	0.151	1.541	244	0.016	0.070	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	PDB:7ajtUO	0.047	0.082	1.864	493	0.018	0.039	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:2c2lA	0.054	0.156	2.253	281	0.014	0.053	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
16	PDB:1ainA	0.036	0.096	2.724	314	0.006	0.019	1ainA.pdb.gz
17	PDB:6qeqA	0.043	0.313	3.509	111	0.014	0.126	6qeqA.pdb.gz
18	PDB:6f44W	0.032	0.154	3.738	172	0.012	0.070	6f44W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:3j79T	0.038	0.172	4.520	181	0.018	0.105	3j79T.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
20	PDB:7nj1A	0.054	0.039	4.815	1448	0.013	0.009	7nj1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75420	0.0	2060	1035	1.000	1.000	GGYF1_HUMAN GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2
2	Q99MR1	0.0	1478	1044	0.893	0.885	GGYF1_MOUSE GRB10-interacting GYF protein 1 OS=Mus musculus OX=10090 GN=Gigyf1 PE=1 SV=2
3	Q6Y7W8	2.56e-99	343	1291	0.204	0.163	GGYF2_MOUSE GRB10-interacting GYF protein 2 OS=Mus musculus OX=10090 GN=Gigyf2 PE=1 SV=2
4	C9JHW1	4.40e-66	239	720	0.160	0.231	C9JHW1_HUMAN GRB10 interacting GYF protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
5	E7ESB6	4.35e-64	235	836	0.148	0.183	E7ESB6_HUMAN GRB10 interacting GYF protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
6	Q6Y7W6	2.70e-63	237	1299	0.148	0.118	GGYF2_HUMAN GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
7	I1E4Y6	3.03e-63	237	1321	0.148	0.116	I1E4Y6_HUMAN GRB10 interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
8	Q7KQM6	1.38e-35	149	1574	0.169	0.111	GGYF1_DROME GIGYF family protein Gyf OS=Drosophila melanogaster OX=7227 GN=Gyf PE=1 SV=2
9	O36025	7.90e-09	62.4	992	0.026	0.027	MPD2_SCHPO GYF domain-containing protein mpd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpd2 PE=1 SV=1
10	P32909	2.05e-07	57.4	740	0.025	0.035	SMY2_YEAST Protein SMY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMY2 PE=1 SV=2
11	Q9FMM3	2.10e-07	57.8	1714	0.024	0.015	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
12	Q02875	3.44e-06	53.5	849	0.025	0.031	SYH1_YEAST SMY2 homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYH1 PE=1 SV=1
13	Q8IDX6	1.37e-05	52.0	3130	0.031	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
14	C6KRN1	1.92e-05	49.7	245	0.021	0.090	SAO1_CAEEL Suppressor of aph-1 OS=Caenorhabditis elegans OX=6239 GN=sao-1 PE=1 SV=1
15	Q9SIV5	1.57e-04	48.5	1773	0.016	0.010	C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana OX=3702 GN=NERD PE=1 SV=3
16	C0H5F4	0.001	45.4	3254	0.019	0.006	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
17	Q02779	0.060	40.0	954	0.031	0.034	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
18	D3ZG83	0.14	38.5	940	0.031	0.034	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
19	Q66L42	0.16	38.5	940	0.031	0.034	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
20	Q9Y114	0.29	37.4	656	0.036	0.056	Q9Y114_DROME BcDNA.GH10229 OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02213 GYF	2e-17	73.9	GYF domain
2	PF14237 GYF_2	0.0073	27.3	GYF domain 2
3	PF15610 PRTase_3	4e+02	11.7	PRTase ComF-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258416	0.993	Eukaryotic translation initiation factor 4E type 2
2	9606.ENSP00000381793	0.959	Growth factor receptor-bound protein 10
3	9606.ENSP00000478754	0.843	Probable ATP-dependent RNA helicase DDX6
4	9606.ENSP00000411409	0.838	E3 ubiquitin-protein ligase ZNF598
5	9606.ENSP00000273064	0.804	CCR4-NOT transcription complex subunit 9
6	9606.ENSP00000318374	0.754	Leukocyte receptor cluster member 8
7	9606.ENSP00000300181	0.748	TSC22 domain family protein 4
8	9606.ENSP00000305260	0.746	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
9	9606.ENSP00000445508	0.731	CCR4-NOT transcription complex subunit 4
10	9606.ENSP00000377298	0.658	Nuclear mitotic apparatus protein 1
11	9606.ENSP00000366604	0.631	Splicing factor 1
12	9606.ENSP00000318641	0.625	Integrator complex subunit 3
13	9606.ENSP00000263915	0.623	Growth factor receptor-bound protein 14
14	9606.ENSP00000403459	0.609	Growth factor receptor-bound protein 7
15	9606.ENSP00000221671	0.602	Uncharacterized protein C19orf44
16	9606.ENSP00000268035	0.582	Insulin-like growth factor 1 receptor
17	9606.ENSP00000242285	0.575	Clathrin light chain A
18	9606.ENSP00000380116	0.573	Proline and serine rich 3
19	9606.ENSP00000266022	0.569	RNA-binding protein 6
20	9606.ENSP00000229195	0.560	CCR4-NOT transcription complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.446	organic cyclic compound binding
GO:1901363	0.445	heterocyclic compound binding
GO:0003676	0.413	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0051716	0.970	cellular response to stimulus
GO:0007154	0.969	cell communication
GO:0023052	0.965	signaling
GO:0007165	0.956	signal transduction
GO:0007169	0.945	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048009	0.900	insulin-like growth factor receptor signaling pathway
GO:0048519	0.372	negative regulation of biological process
GO:0019222	0.348	regulation of metabolic process
GO:0048523	0.343	negative regulation of cellular process
GO:0060255	0.318	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0110165	0.948	cellular anatomical entity
GO:0005829	0.935	cytosol
GO:0043226	0.515	organelle
GO:0005634	0.446	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]