StarFunc result for job id O75426

User Input

>input (580 residues)
MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSL
VLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSH
DIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMK
EIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75426	1.000	1.000	0.000	580	1.000	1.000	O75426.pdb.gz	FBX24_HUMAN F-box only protein 24 OS=Homo sapiens OX=9606 GN=FBXO24 PE=1 SV=2
2	AFDB:D2X8A0	0.416	0.348	2.647E-16	708	0.129	0.106	D2X8A0.pdb.gz
3	AFDB:Q8TD19	0.415	0.259	5.179E-16	979	0.119	0.070	Q8TD19.pdb.gz	NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2
4	AFDB:Q9UII4	0.428	0.255	9.624E-16	1024	0.103	0.059	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
5	PDB:5tbkI	0.447	0.596	1.013E-15	419	0.095	0.131	5tbkI.pdb.gz
6	AFDB:Q54PV1	0.389	0.141	2.438E-15	1800	0.117	0.038	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
7	AFDB:A0A0S2Z404	0.449	0.560	5.288E-15	452	0.098	0.126	A0A0S2Z404.pdb.gz	A0A0S2Z404_HUMAN Regulator of chromosome condensation 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RCC1 PE=2 SV=1
8	AFDB:Q92834	0.424	0.255	5.863E-15	1020	0.117	0.067	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
9	AFDB:Q9FJG9	0.418	0.531	9.826E-15	445	0.110	0.144	Q9FJG9.pdb.gz	RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RUG3 PE=1 SV=1
10	AFDB:Q8VE37	0.447	0.592	1.089E-14	421	0.095	0.131	Q8VE37.pdb.gz	RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus OX=10090 GN=Rcc1 PE=1 SV=1
11	AFDB:Q9R0X5	0.409	0.253	1.272E-14	1001	0.114	0.066	Q9R0X5.pdb.gz	RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus OX=10090 GN=Rpgr PE=1 SV=2
12	PDB:8gqeB	0.375	0.539	1.516E-13	386	0.102	0.153	8gqeB.pdb.gz
13	PDB:5xgsA	0.425	0.596	3.647E-13	398	0.114	0.166	5xgsA.pdb.gz
14	PDB:5t94A	0.413	0.512	3.840E-13	454	0.093	0.119	5t94A.pdb.gz
15	PDB:4d4oA	0.391	0.526	2.490E-9	414	0.081	0.114	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
16	PDB:7z8bF	0.313	0.378	4.873E-9	457	0.079	0.101	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
17	PDB:6ttuT	0.288	0.398	1.631E-7	394	0.079	0.117	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	PDB:5yzgW	0.274	0.344	2.341E-7	440	0.050	0.066	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:7kzmD	0.328	0.399	4.824E-7	456	0.095	0.121	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
20	PDB:7mq8LN	0.239	0.212	4.824E-7	671	0.064	0.055	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75426	0.0	1197	580	1.000	1.000	FBX24_HUMAN F-box only protein 24 OS=Homo sapiens OX=9606 GN=FBXO24 PE=1 SV=2
2	B8A4R1	1.44e-07	56.6	531	0.090	0.098	B8A4R1_DANRE RCC1 and BTB domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=fj43a07 PE=1 SV=1
3	Q7ZVG0	1.51e-07	56.6	531	0.090	0.098	Q7ZVG0_DANRE RCC1 and BTB domain-containing protein 1 OS=Danio rerio OX=7955 GN=wu:fj43a07 PE=1 SV=1
4	Q9M2S1	1.90e-06	53.1	488	0.055	0.066	Q9M2S1_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=TCF1 PE=1 SV=1
5	E9PZP8	1.30e-05	50.8	4859	0.078	0.009	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
6	Q15751	1.30e-05	50.8	4861	0.078	0.009	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
7	O95199	1.67e-05	50.1	551	0.074	0.078	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1
8	Q8BNF7	1.70e-05	50.4	1203	0.116	0.056	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
9	Q99LJ7	2.09e-05	49.7	551	0.076	0.080	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1
10	F1QEL3	2.69e-05	49.7	708	0.064	0.052	F1QEL3_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
11	Q8NDN9	3.41e-05	48.9	531	0.079	0.087	RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCBTB1 PE=1 SV=1
12	F1QM29	3.78e-05	49.3	1413	0.064	0.026	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
13	Q54D12	1.14e-04	47.4	455	0.079	0.101	Q54D12_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292586 PE=4 SV=1
14	Q9P258	2.49e-04	46.2	522	0.064	0.071	RCC2_HUMAN Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2
15	Q8BK67	4.37e-04	45.4	520	0.069	0.077	RCC2_MOUSE Protein RCC2 OS=Mus musculus OX=10090 GN=Rcc2 PE=1 SV=1
16	Q9FN03	4.63e-04	45.4	440	0.069	0.091	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
17	Q0VGT7	5.98e-04	44.7	347	0.031	0.052	Q0VGT7_MOUSE Fbxw7 protein OS=Mus musculus OX=10090 GN=Fbxw7 PE=2 SV=1
18	B7ZDC8	0.001	44.3	544	0.031	0.033	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
19	Q0WSJ9	0.001	44.3	393	0.055	0.081	Q0WSJ9_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=1 SV=1
20	Q8VBV4	0.001	44.3	710	0.031	0.025	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	4.1e-05	34.6	F-box domain
2	PF12937 F-box-like	4.2e-07	41.0	F-box-like
3	PF15966 F-box_4	1.1e+02	14.1	F-box
4	PF00415 RCC1	0.0021	29.9	Regulator of chromosome condensation (RCC1) repeat
5	PF14433 SUKH-3	3.8e+02	12.9	SUKH-3 immunity protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033376

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000060053	0.780	S-phase kinase-associated protein 1
2	9598.ENSPTRP00000035010	0.724	Ankyrin repeat domain 46
3	9598.ENSPTRP00000010266	0.703	Uncharacterized protein
4	9598.ENSPTRP00000022193	0.694	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2
5	9598.ENSPTRP00000007413	0.690	Ring finger protein 214
6	9598.ENSPTRP00000033967	0.690	Cullin-1
7	9598.ENSPTRP00000048297	0.671	Cysteinyl-tRNA synthetase
8	9598.ENSPTRP00000038132	0.670	Cysteine protease
9	9598.ENSPTRP00000033362	0.667	Uncharacterized protein
10	9598.ENSPTRP00000045773	0.667	Rhomboid domain containing 1
11	9598.ENSPTRP00000005266	0.634	Chromosome 10 open reading frame 46
12	9598.ENSPTRP00000022190	0.634	Cullin 3
13	9598.ENSPTRP00000033367	0.612	ArfGAP with FG repeats 2
14	9598.ENSPTRP00000058119	0.608	Uncharacterized protein
15	9598.ENSPTRP00000016388	0.604	CASK interacting protein 2
16	9598.ENSPTRP00000053360	0.601	Family with sequence similarity 155, member A
17	9598.ENSPTRP00000033370	0.599	Leucine-rich repeats and calponin homology (CH) domain containing 4
18	9598.ENSPTRP00000017019	0.591	Ribosomal protein L17
19	9598.ENSPTRP00000047545	0.591	Negative regulator of ubiquitin-like proteins 1
20	9598.ENSPTRP00000022921	0.590	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.988	regulation of biological process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0019538	0.978	protein metabolic process
GO:0050794	0.974	regulation of cellular process
GO:0044237	0.942	cellular metabolic process
GO:0030163	0.915	protein catabolic process
GO:0016567	0.886	protein ubiquitination
GO:0010498	0.868	proteasomal protein catabolic process
GO:0044260	0.866	cellular macromolecule metabolic process
GO:0019941	0.825	modification-dependent protein catabolic process
GO:0006511	0.805	ubiquitin-dependent protein catabolic process
GO:0019222	0.764	regulation of metabolic process
GO:0048518	0.748	positive regulation of biological process
GO:0060255	0.726	regulation of macromolecule metabolic process
GO:0080090	0.656	regulation of primary metabolic process
GO:0051171	0.656	regulation of nitrogen compound metabolic process
GO:0048519	0.645	negative regulation of biological process
GO:0048523	0.622	negative regulation of cellular process
GO:0050896	0.402	response to stimulus
GO:0048583	0.355	regulation of response to stimulus
GO:0031323	0.307	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0032991	0.969	protein-containing complex
GO:0043226	0.960	organelle
GO:0005829	0.936	cytosol
GO:0043227	0.829	membrane-bounded organelle
GO:0043229	0.781	intracellular organelle
GO:0043231	0.619	intracellular membrane-bounded organelle
GO:1990234	0.421	transferase complex
GO:0140535	0.396	intracellular protein-containing complex
GO:0000151	0.389	ubiquitin ligase complex
GO:0005634	0.337	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]