StarFunc result for job id O75439

User Input

>input (489 residues)
MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRV
TCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLE
LEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILR
EMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPRIV
LAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAIAV
EAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDT
GLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICE
DIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQI
RSNMCWLRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03346	0.914	0.914	9.385E-83	489	0.896	0.896	Q03346.pdb.gz	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
2	AFDB:G3V0E4	0.911	0.909	2.351E-82	490	0.961	0.959	G3V0E4.pdb.gz	G3V0E4_HUMAN Peptidase (Mitochondrial processing) beta, isoform CRA_c OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=1
3	AFDB:Q9VFF0	0.902	0.938	4.756E-66	470	0.642	0.668	Q9VFF0.pdb.gz	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
4	AFDB:Q68FY0	0.898	0.915	3.559E-61	480	0.536	0.546	Q68FY0.pdb.gz	QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrc1 PE=1 SV=1
5	AFDB:P31930	0.898	0.914	3.914E-60	480	0.536	0.546	P31930.pdb.gz	QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3
6	PDB:7o37A	0.885	0.970	4.459E-58	446	0.521	0.572	7o37A.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
7	AFDB:Q5BFD3	0.865	0.882	1.304E-56	479	0.470	0.480	Q5BFD3.pdb.gz	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1
8	AFDB:Q42290	0.873	0.804	2.513E-55	531	0.481	0.443	Q42290.pdb.gz	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
9	PDB:5xteY	0.885	0.969	4.563E-54	446	0.519	0.570	5xteY.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
10	AFDB:Q9P7X1	0.869	0.929	5.364E-54	457	0.448	0.479	Q9P7X1.pdb.gz	MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr1 PE=2 SV=1
11	AFDB:Q4W6B5	0.883	0.920	2.207E-51	469	0.395	0.412	Q4W6B5.pdb.gz	MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum OX=44689 GN=mppB PE=1 SV=1
12	AFDB:Q23295	0.848	0.904	2.848E-51	458	0.448	0.478	Q23295.pdb.gz	MPPB_CAEEL Mitochondrial-processing peptidase subunit beta OS=Caenorhabditis elegans OX=6239 GN=mppb-1 PE=1 SV=2
13	PDB:1hr6D	0.848	0.934	6.254E-48	443	0.407	0.449	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
14	PDB:1kb9A	0.805	0.909	3.824E-36	431	0.237	0.269	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
15	PDB:1hr6A	0.809	0.864	2.758E-33	457	0.241	0.258	1hr6A.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
16	PDB:7o37B	0.806	0.934	1.039E-32	420	0.211	0.245	7o37B.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
17	PDB:3hdiA	0.781	0.917	3.719E-32	414	0.239	0.283	3hdiA.pdb.gz	Crystal and solution structures of a prokaryotic M16B peptidase: an open and shut case.
18	PDB:5xteK	0.796	0.924	5.516E-30	419	0.207	0.241	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
19	PDB:6ofsA	0.708	0.403	1.614E-22	905	0.155	0.084	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
20	PDB:1q2lA	0.610	0.339	7.403E-21	937	0.184	0.096	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V0E4	0.0	976	490	0.959	0.957	G3V0E4_HUMAN Peptidase (Mitochondrial processing) beta, isoform CRA_c OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=1
2	O75439	0.0	1019	489	1.000	1.000	MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2
3	P31930	0.0	566	480	0.528	0.537	QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3
4	Q03346	0.0	924	489	0.896	0.896	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
5	Q68FY0	0.0	567	480	0.526	0.535	QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrc1 PE=1 SV=1
6	Q9CXT8	0.0	923	489	0.902	0.902	MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus OX=10090 GN=Pmpcb PE=1 SV=1
7	Q9CZ13	0.0	571	480	0.530	0.540	QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2
8	Q9VFF0	0.0	658	470	0.646	0.672	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
9	Q42290	8.15e-168	486	531	0.472	0.435	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
10	Q5BFD3	6.20e-163	471	479	0.495	0.505	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1
11	Q23295	3.15e-153	446	458	0.440	0.469	MPPB_CAEEL Mitochondrial-processing peptidase subunit beta OS=Caenorhabditis elegans OX=6239 GN=mppb-1 PE=1 SV=2
12	Q9P7X1	3.03e-149	436	457	0.448	0.479	MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr1 PE=2 SV=1
13	Q4W6B5	9.82e-136	402	469	0.395	0.412	MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum OX=44689 GN=mppB PE=1 SV=1
14	P10507	1.76e-133	395	462	0.409	0.433	MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS1 PE=1 SV=1
15	A0A1D8PCY8	2.96e-127	380	467	0.409	0.428	A0A1D8PCY8_CANAL Mas1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS1 PE=3 SV=1
16	P98080	1.24e-113	345	471	0.354	0.367	UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ucr-1 PE=3 SV=2
17	Q38F91	7.68e-75	245	477	0.311	0.319	Q38F91_TRYB2 Mitochondrial processing peptide beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3110 PE=3 SV=1
18	Q57W51	6.99e-64	217	489	0.305	0.305	Q57W51_TRYB2 Mitochondrial processing peptidase, beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.230 PE=4 SV=1
19	Q9KA85	2.01e-58	200	413	0.249	0.295	Q9KA85_HALH5 Processing protease OS=Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=BH2405 PE=1 SV=1
20	P9WHT5	3.11e-53	187	438	0.274	0.306	Y2782_MYCTU Uncharacterized zinc protease Rv2782c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2782c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00675 Peptidase_M16	4.5e-54	193.9	Insulinase (Peptidase family M16)
2	PF05193 Peptidase_M16_C	1.7e-33	127.8	Peptidase M16 inactive domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249269

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360782	0.997	Mitochondrial-processing peptidase subunit alpha
2	9606.ENSP00000268379	0.988	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9606.ENSP00000262030	0.986	ATP synthase subunit beta, mitochondrial
4	9606.ENSP00000317159	0.978	Cytochrome c1, heme protein, mitochondrial
5	9606.ENSP00000441875	0.976	Prohibitin-2
6	9606.ENSP00000356256	0.969	Mitochondrial import inner membrane translocase subunit Tim17-A
7	9606.ENSP00000306397	0.968	Cytochrome b-c1 complex subunit Rieske, mitochondrial
8	9606.ENSP00000366482	0.968	Frataxin, mitochondrial
9	9606.ENSP00000269143	0.965	AFG3-like protein 2
10	9606.ENSP00000297185	0.963	Stress-70 protein, mitochondrial
11	9606.ENSP00000315693	0.963	Mitochondrial import inner membrane translocase subunit TIM16
12	9606.ENSP00000268704	0.960	Paraplegin
13	9606.ENSP00000373620	0.960	60 kDa heat shock protein, mitochondrial
14	9606.ENSP00000169551	0.957	Mitochondrial import inner membrane translocase subunit Tim21
15	9606.ENSP00000445806	0.955	Mitochondrial import inner membrane translocase subunit TIM50
16	9606.ENSP00000372005	0.953	Mitochondrial import inner membrane translocase subunit TIM14
17	9606.ENSP00000270538	0.949	Mitochondrial import inner membrane translocase subunit TIM44
18	9606.ENSP00000379999	0.947	Translocase of inner mitochondrial membrane 17B
19	9606.ENSP00000464522	0.947	Mitochondrial import inner membrane translocase subunit Tim23
20	9606.ENSP00000215375	0.946	ATP synthase subunit delta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	0.997	metalloendopeptidase activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051604	0.998	protein maturation
GO:0006626	0.998	protein targeting to mitochondrion
GO:0006508	0.996	proteolysis
GO:0016485	0.994	protein processing
GO:0044237	0.410	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.997	membrane
GO:0031966	0.991	mitochondrial membrane
GO:0019866	0.967	organelle inner membrane
GO:0032991	0.930	protein-containing complex
GO:0005743	0.907	mitochondrial inner membrane
GO:0070013	0.886	intracellular organelle lumen
GO:0098798	0.436	mitochondrial protein-containing complex
GO:0005759	0.436	mitochondrial matrix
GO:1902494	0.350	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	0.997	Metalloendopeptidases.

[back to server]