StarFunc result for job id O75443

User Input

>input (2155 residues)
MNYSSFLRIWVSFIFALVQHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFVAPFWADVHNGIRGEIYYRETMEPA
ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPEIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTVKCRCLDFNNEIYCQEASCS
PYEVCEPKGKFFYCSAVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF
FSVEAKNEHRRGSAVSWVKELSVEVNGYKILIPKGSYGRVKVNDLVTSLPVTLDLGTVKI
YQSGISTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV
VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVQCPSF
SHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNQGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCGSGEVCAVEDGYQGCFPKRETVCLLSQNQV
LHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKI
GGIGASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESKGVVTVQYSDIGLLYIRLSTT
YFNCTGGLCGFYNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARY
ASACKNADVEVGPWRTYDFCPLECPENSHFEECITCTETCETLTLGPICVDSCSEGCQCD
EGYALLGSQCVTRSECGCNFEGHQLATNETFWVDLDCQIFCYCSGTDNRVHCETIPCKDD
EYCMEEGGLYYCQARTDASCIVSGYGHYLTFDGFPFDFQTSCPLILCTTGSRPSSDSFPK
FVVTAKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINI
FSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPMGLLA
SSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAAFSKCHSKVNP
TFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGITVTGWRNYTSCTVTCPPNSHYES
CVSVCQPRCAAIRLKSDCSHYCVEGCHCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLF
WNSDCTRRCRCFRRNVIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDG
AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIISPVYFYINEEQILINDRN
TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG
LCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKRPLAPSCNELQFSQYAAMCDNV
HIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYSHKKFQLCGSLAAYGEA
CRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDII
DAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNI
VQSNGTHIMYKNTLWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVIN
LTVPTQEGSFITKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADATHLILTLNKC
YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHC
AVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTS
RVDGPLCSCVTGTLQEDGKSCRASNSSMELQVWTLLLIMIQISLWHFVYKSGTTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q0B5	0.206	0.176	0.000	2583	0.247	0.206	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
2	AFDB:F1QK57	0.344	0.338	0.000	2201	0.606	0.593	F1QK57.pdb.gz
3	AFDB:O08523	0.768	0.768	0.000	2155	0.958	0.958	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
4	AFDB:Q28983	0.189	0.166	0.000	2476	0.208	0.181	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
5	AFDB:Q98UI9	0.137	0.139	2.917E-75	2108	0.184	0.188	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
6	AFDB:Q3ZCN5	0.142	0.132	4.843E-70	2332	0.183	0.169	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
7	AFDB:A0A286YAF1	0.142	0.143	4.174E-62	2146	0.167	0.167	A0A286YAF1.pdb.gz
8	AFDB:Q80Z19	0.139	0.113	4.977E-62	2680	0.185	0.149	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
9	AFDB:Q6W4X9	0.136	0.122	7.054E-55	2439	0.128	0.113	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
10	AFDB:A0A0G2K1Y4	0.135	0.254	1.003E-54	1103	0.116	0.226	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
11	PDB:4wrnA	0.076	0.226	3.260E-21	693	0.054	0.167	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
12	PDB:4wrnB	0.075	0.230	1.190E-18	663	0.056	0.183	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
13	PDB:5hzvA	0.056	0.187	1.030E-7	598	0.017	0.062	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
14	PDB:7d4iBE	0.039	0.071	1.101E-2	890	0.045	0.110	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
15	PDB:3d4gE	0.043	0.179	1.313E-2	472	0.010	0.047	3d4gE.pdb.gz	Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
16	PDB:4pfeA	0.037	0.196	3.311E-2	342	0.013	0.079	4pfeA.pdb.gz
17	PDB:6xk9Y	0.048	0.074	4.312E-2	1106	0.052	0.102	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
18	PDB:3zhlA	0.042	0.516	6.409E-2	121	0.006	0.116	3zhlA.pdb.gz
19	PDB:6lqsBE	0.042	0.069	6.409E-2	823	0.020	0.053	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:6xt9A	0.039	0.084	6.697E-2	567	0.033	0.125	6xt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q0B5	0.0	662	2583	0.213	0.178	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
2	E9Q9C6	0.0	663	2583	0.213	0.178	E9Q9C6_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
3	O08523	0.0	4287	2155	0.959	0.959	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
4	O75443	0.0	4459	2155	1.000	1.000	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
5	Q9Y6R7	0.0	653	5405	0.205	0.082	FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3
6	Q28983	1.15e-175	598	2476	0.202	0.176	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
7	Q8K0P6	1.51e-168	553	1205	0.178	0.319	Q8K0P6_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
8	O88799	3.58e-139	489	5376	0.165	0.066	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
9	Q8R0K8	1.14e-83	292	657	0.088	0.288	Q8R0K8_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
10	Q58E52	1.52e-75	267	615	0.081	0.283	Q58E52_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
11	Q70E20	2.75e-73	273	1403	0.059	0.091	SNED1_MOUSE Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2
12	Q8TER0	6.60e-73	272	1413	0.058	0.089	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
13	Q6IS34	9.87e-71	252	592	0.077	0.282	Q6IS34_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
14	Q8C5Q6	8.51e-65	226	333	0.051	0.330	Q8C5Q6_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
15	E7F9Z1	3.02e-64	246	2812	0.097	0.074	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
16	Q7TNG6	2.49e-62	224	493	0.064	0.280	Q7TNG6_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
17	Q8CIZ8	7.32e-62	238	2813	0.096	0.073	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
18	Q8R1H9	3.54e-61	220	476	0.060	0.273	Q8R1H9_MOUSE Fcgbp protein (Fragment) OS=Mus musculus OX=10090 GN=Fcgbp PE=2 SV=1
19	P25291	6.17e-58	212	509	0.056	0.238	GP2_CANLF Pancreatic secretory granule membrane major glycoprotein GP2 OS=Canis lupus familiaris OX=9615 GN=GP2 PE=1 SV=1
20	P07911	6.85e-58	215	640	0.052	0.177	UROM_HUMAN Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	2.5e-56	199.2	C8 domain
2	PF14670 FXa_inhibition	0.076	24.7	Coagulation Factor Xa inhibitory site
3	PF06119 NIDO	6.9e-24	95.8	Nidogen-like
4	PF01826 TIL	1.4e-21	87.8	Trypsin Inhibitor like cysteine rich domain
5	PF12714 TILa	3.3e-15	67.1	TILa domain
6	PF00094 VWD	6.6e-144	486.3	von Willebrand factor type D domain
7	PF00100 Zona_pellucida	4.4e-43	159.4	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403925	0.892	Tubulin-specific chaperone cofactor E-like protein
2	9606.ENSP00000466561	0.890	Carcinoembryonic antigen-related cell adhesion molecule 16
3	9606.ENSP00000373610	0.830	Otoancorin
4	9606.ENSP00000330808	0.785	Otolin-1
5	9606.ENSP00000375849	0.758	Otospiralin
6	9606.ENSP00000356807	0.692	TIP41-like protein
7	9606.ENSP00000401513	0.659	Stereocilin
8	9606.ENSP00000284987	0.635	A disintegrin and metalloproteinase with thrombospondin motifs 5
9	9606.ENSP00000299308	0.577	Transmembrane protein 132B
10	9606.ENSP00000379862	0.572	Cochlin
11	9606.ENSP00000363840	0.563	Collagen alpha-2(XI) chain
12	9606.ENSP00000205890	0.556	Unconventional myosin-XV
13	9606.ENSP00000252321	0.537	Potassium voltage-gated channel subfamily A member 5
14	9606.ENSP00000277903	0.533	Hyaluronan-binding protein 2
15	9606.ENSP00000254627	0.527	Otoconin 90
16	9606.ENSP00000262283	0.527	Otoconin-90
17	9606.ENSP00000386331	0.516	Unconventional myosin-VIIa
18	9606.ENSP00000315731	0.508	Meteorin-like protein
19	9606.ENSP00000372295	0.503	Gap junction beta-2 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.998	multicellular organismal process
GO:0003008	0.969	system process
GO:0007600	0.955	sensory perception
GO:0007605	0.951	sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005576	0.995	extracellular region
GO:0043227	0.994	membrane-bounded organelle
GO:0005886	0.992	plasma membrane
GO:0005615	0.952	extracellular space
GO:0030312	0.945	external encapsulating structure
GO:0070062	0.935	extracellular exosome
GO:0031012	0.760	extracellular matrix
GO:0005737	0.681	cytoplasm
GO:0043229	0.344	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]