StarFunc result for job id O75445

User Input

>input (1400 residues)
MNCPVLSLGSGFLFQVIEMLIFAYFASISLTESRGLFPRLENVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSASFIFGNHKSCFSSPPSPKLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFNAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNNFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVYAFNCKPCQCNSHSKSCHYNISVDPFPFEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDTVGTRNGSILCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDHCNFGFKFLRSFNDVGCEPCQCNLHGSVNKFCNPHSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGNFYLRQNN
SFLCLPCNCDKTGTINGSLLCNKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQHCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQRCDQCKDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLDTDLLPYTKYSYYIETTNVHGSTRSVAVT
YKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYDFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKMQKISSTELH
VEWSPPAELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPHSFVESANENALKPP
QTMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11046	0.206	0.169	1.409E-53	1788	0.177	0.139	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
2	AFDB:A0A0R4IDN1	0.250	0.203	6.849E-52	1785	0.180	0.141	A0A0R4IDN1.pdb.gz
3	AFDB:O44565	0.212	0.172	3.173E-51	1790	0.171	0.134	O44565.pdb.gz	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
4	AFDB:P15215	0.181	0.156	4.311E-51	1639	0.171	0.146	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
5	AFDB:P55268	0.233	0.185	5.289E-51	1798	0.181	0.141	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
6	AFDB:D3ZQN7	0.207	0.166	2.713E-50	1786	0.183	0.143	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
7	AFDB:Q61292	0.200	0.158	2.713E-50	1799	0.180	0.140	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
8	AFDB:Q18823	0.189	0.164	1.135E-49	1633	0.173	0.148	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
9	AFDB:B7ZDA6	0.206	0.166	1.190E-48	1782	0.170	0.134	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
10	AFDB:Q13751	0.213	0.249	8.545E-41	1172	0.118	0.141	Q13751.pdb.gz	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
11	PDB:6pxvA	0.135	0.208	1.115E-13	823	0.042	0.072	6pxvA.pdb.gz
12	PDB:8eyyA	0.142	0.231	2.943E-13	775	0.044	0.079	8eyyA.pdb.gz
13	PDB:8dtlA	0.145	0.246	8.179E-13	741	0.049	0.093	8dtlA.pdb.gz
14	PDB:6pyhD	0.140	0.224	1.355E-10	798	0.038	0.066	6pyhD.pdb.gz
15	PDB:7u7nC	0.075	0.369	1.094E-7	200	0.031	0.220	7u7nC.pdb.gz
16	PDB:5oj2B	0.093	0.159	1.824E-7	692	0.027	0.055	5oj2B.pdb.gz
17	PDB:7q1yA	0.079	0.081	2.238E-7	1374	0.026	0.026	7q1yA.pdb.gz
18	PDB:7ufgB	0.103	0.121	2.745E-7	1182	0.096	0.113	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
19	PDB:2a3wA	0.103	0.630	3.200E-7	204	0.024	0.162	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
20	PDB:7bwaA	0.115	0.222	4.576E-7	674	0.031	0.064	7bwaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75445	0.0	2953	5202	1.000	0.269	USH2A_HUMAN Usherin OS=Homo sapiens OX=9606 GN=USH2A PE=1 SV=3
2	Q2QI47	0.0	2115	5193	0.710	0.191	USH2A_MOUSE Usherin OS=Mus musculus OX=10090 GN=Ush2A PE=1 SV=2
3	Q8K3K1	0.0	2054	5125	0.696	0.190	USH2A_RAT Usherin OS=Rattus norvegicus OX=10116 GN=Ush2a PE=1 SV=2
4	C1P640	2.65e-98	352	3683	0.191	0.073	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
5	Q21313	3.17e-98	352	3672	0.191	0.073	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	C1P641	3.59e-98	352	3663	0.191	0.073	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
7	G5EEV6	3.99e-98	351	3704	0.191	0.072	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
8	A0A8I6A4V6	1.81e-96	346	3699	0.194	0.073	A0A8I6A4V6_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=1
9	F1MAN8	1.84e-96	346	3713	0.183	0.069	F1MAN8_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=2
10	O15230	3.53e-96	345	3695	0.183	0.069	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
11	Q61001	1.00e-95	344	3718	0.183	0.069	LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus OX=10090 GN=Lama5 PE=1 SV=4
12	Q2Q1W5	1.11e-91	331	3664	0.169	0.065	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
13	Q00174	7.84e-90	325	3712	0.166	0.063	LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster OX=7227 GN=LanA PE=1 SV=2
14	A0A1B0GWM3	3.15e-79	292	3333	0.148	0.062	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
15	A0A0A0MSA0	1.50e-77	287	3277	0.146	0.063	A0A0A0MSA0_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
16	Q16787	1.52e-77	287	3333	0.146	0.062	LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=3
17	Q61789	7.13e-77	285	3330	0.152	0.064	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4
18	Q13751	1.15e-71	265	1172	0.115	0.137	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
19	G5ECE3	1.23e-71	268	3102	0.140	0.063	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
20	P02469	1.63e-70	263	1786	0.119	0.094	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08329 ChitinaseA_N	2.2e+02	12.9	Chitinase A, N-terminal domain
2	PF00041 fn3	5.4e-30	114.9	Fibronectin type III domain
3	PF00053 Laminin_EGF	1.4e-80	276.6	Laminin EGF domain
4	PF13385 Laminin_G_3	6.5e-12	57.3	Concanavalin A-like lectin/glucanases superfamily
5	PF00055 Laminin_N	1.6e-26	104.8	Laminin N-terminal (Domain VI)
6	PF16656 Pur_ac_phosph_N	1.5e-05	36.9	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354623	0.995	Whirlin
2	9606.ENSP00000005226	0.988	Harmonin
3	9606.ENSP00000480489	0.967	PDZ domain-containing protein 7
4	9606.ENSP00000410083	0.941	Vezatin
5	9606.ENSP00000480279	0.896	Usher syndrome type-1G protein
6	9606.ENSP00000329158	0.891	Clarin-1
7	9606.ENSP00000386331	0.871	Unconventional myosin-VIIa
8	9606.ENSP00000363068	0.865	Protocadherin-15
9	9606.ENSP00000258930	0.856	Calcium and integrin-binding family member 2
10	9606.ENSP00000376686	0.853	Lebercilin
11	9606.ENSP00000381768	0.852	Cadherin-23
12	9606.ENSP00000384582	0.851	G-protein coupled receptor 98
13	9606.ENSP00000304051	0.828	E3 ubiquitin-protein ligase RNF139
14	9606.ENSP00000278886	0.818	Ninein-like protein
15	9606.ENSP00000222399	0.814	Laminin subunit beta-1
16	9606.ENSP00000388325	0.814	Laminin subunit beta-2
17	9606.ENSP00000259154	0.769	BTB/POZ domain-containing protein KCTD3
18	9606.ENSP00000359245	0.766	Retinal-specific ATP-binding cassette transporter
19	9606.ENSP00000252999	0.765	Laminin subunit alpha-5
20	9606.ENSP00000324532	0.765	Laminin subunit alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0005518	0.992	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.955	multicellular organismal process
GO:0050953	0.899	sensory perception of light stimulus
GO:0060249	0.867	anatomical structure homeostasis
GO:0048856	0.860	anatomical structure development
GO:0001894	0.838	tissue homeostasis
GO:0001895	0.821	retina homeostasis
GO:0065007	0.695	biological regulation
GO:0050789	0.688	regulation of biological process
GO:0045494	0.682	photoreceptor cell maintenance
GO:0048513	0.633	animal organ development
GO:0050794	0.374	regulation of cellular process
GO:0007275	0.315	multicellular organism development
GO:0048731	0.314	system development
GO:0050954	0.310	sensory perception of mechanical stimulus
GO:0009987	0.303	cellular process
GO:0050793	0.302	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.984	cell periphery
GO:0062023	0.951	collagen-containing extracellular matrix
GO:0005737	0.914	cytoplasm
GO:0005604	0.914	basement membrane
GO:0043226	0.407	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]