StarFunc result for job id O75448

User Input

>input (989 residues)
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLI
LSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGL
CRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHI
AKLEEASSWTAIEHSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTG
FPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVLEIWKACFVGLIESPEGT
EELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCT
NFLLQECGKQGLLSEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNI
LKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFINLNEFTTYGSE
ESTKPASVRALLFDISFLMLCHVAQTYGSEVILSESRTGAEVPFFETWMQTCMPEEGKIL
NPDHPCFRPDSTKVESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFE
SIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMIRQLAGPLFSENTLQFYN
ERVVIMNSILERMCADVLQQTATQIKFPSTGVDTMPYWNLLPPKRPIKEVLTDIFAKVLE
KGWVDSRSIHIFDTLLHMGGVYWFCNNLIKELLKETRKEHTLRAVELLYSIFCLDMQQVT
LVLLGHILPGLLTDSSKWHSLMDPPGTALAKLAVWCALSSYSSHKGQASTRQKKRHREDI
EDYISLFPLDDVQPSKLMRLLSSNEDDANILSSPTDRSMSSSLSASQLHTVNMRDPLNRV
LANLFLLISSILGSRTAGPHTQFVQWFMEECVDCLEQGGRGSVLQFMPFTTVSELVKVSA
MSSPKVVLAITDLSLPLGRQVAAKAIAAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75448	1.000	1.000	0.000	989	1.000	1.000	O75448.pdb.gz	MED24_HUMAN Mediator of RNA polymerase II transcription subunit 24 OS=Homo sapiens OX=9606 GN=MED24 PE=1 SV=1
2	AFDB:Q2PW47	0.955	0.955	3.125E-92	989	0.761	0.761	Q2PW47.pdb.gz	MED24_DANRE Mediator of RNA polymerase II transcription subunit 24 OS=Danio rerio OX=7955 GN=med24 PE=2 SV=2
3	PDB:7lbm2	0.870	0.956	3.074E-78	897	0.901	0.993	7lbm2.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
4	PDB:6w1sS	0.834	0.911	9.546E-62	901	0.845	0.928	6w1sS.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
5	AFDB:Q9VSF2	0.826	0.823	4.948E-42	993	0.269	0.268	Q9VSF2.pdb.gz	MED24_DROME Mediator of RNA polymerase II transcription subunit 24 OS=Drosophila melanogaster OX=7227 GN=MED24 PE=1 SV=2
6	AFDB:Q10573	0.609	0.540	4.449E-19	1139	0.145	0.126	Q10573.pdb.gz	LIN25_CAEEL Protein lin-25 OS=Caenorhabditis elegans OX=6239 GN=lin-25 PE=1 SV=1
7	AFDB:Q9LUG9	0.559	0.442	4.221E-10	1309	0.167	0.126	Q9LUG9.pdb.gz	MD33A_ARATH Mediator of RNA polymerase II transcription subunit 33A OS=Arabidopsis thaliana OX=3702 GN=MED33A PE=1 SV=1
8	AFDB:P53114	0.349	0.314	1.287E-7	1132	0.137	0.119	P53114.pdb.gz	MED5_YEAST Mediator of RNA polymerase II transcription subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUT1 PE=1 SV=1
9	PDB:7qenD	0.121	0.116	1.043E-4	1050	0.125	0.118	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
10	PDB:2xwuB	0.133	0.141	2.875E-4	910	0.137	0.148	2xwuB.pdb.gz
11	AFDB:Q38AC2	0.091	0.053	4.125E-4	2432	0.121	0.049	Q38AC2.pdb.gz	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
12	PDB:7q2xD	0.094	0.094	4.129E-4	994	0.108	0.108	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
13	PDB:7wjiB	0.127	0.088	5.720E-4	1663	0.142	0.084	7wjiB.pdb.gz
14	AFDB:F4I8B3	0.123	0.110	6.143E-4	1203	0.129	0.106	F4I8B3.pdb.gz	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
15	AFDB:Q86C65	0.105	0.062	7.362E-4	2380	0.137	0.057	Q86C65.pdb.gz	TOR_DICDI Serine/threonine-protein kinase tor OS=Dictyostelium discoideum OX=44689 GN=tor PE=1 SV=1
16	AFDB:Q960B1	0.113	0.115	7.362E-4	947	0.132	0.138	Q960B1.pdb.gz	Q960B1_DROME SD10334p OS=Drosophila melanogaster OX=7227 GN=unc-45 PE=1 SV=1
17	PDB:7r04B	0.119	0.077	1.021E-3	2229	0.157	0.070	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:6ahd1	0.127	0.123	1.097E-3	1048	0.116	0.110	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
19	PDB:7su3A	0.102	0.050	1.315E-3	3802	0.139	0.036	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
20	PDB:6qnxA	0.117	0.121	1.959E-3	928	0.112	0.120	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75448	0.0	2041	989	1.000	1.000	MED24_HUMAN Mediator of RNA polymerase II transcription subunit 24 OS=Homo sapiens OX=9606 GN=MED24 PE=1 SV=1
2	Q2PW47	0.0	1509	989	0.761	0.761	MED24_DANRE Mediator of RNA polymerase II transcription subunit 24 OS=Danio rerio OX=7955 GN=med24 PE=2 SV=2
3	Q4V8B3	0.0	1913	987	0.945	0.947	MED24_RAT Mediator of RNA polymerase II transcription subunit 24 OS=Rattus norvegicus OX=10116 GN=Med24 PE=1 SV=1
4	Q99K74	0.0	1905	987	0.942	0.944	MED24_MOUSE Mediator of RNA polymerase II transcription subunit 24 OS=Mus musculus OX=10090 GN=Med24 PE=1 SV=1
5	Q9VSF2	4.98e-118	387	993	0.280	0.279	MED24_DROME Mediator of RNA polymerase II transcription subunit 24 OS=Drosophila melanogaster OX=7227 GN=MED24 PE=1 SV=2
6	P51398	3.8	33.5	398	0.018	0.045	RT29_HUMAN Small ribosomal subunit protein mS29 OS=Homo sapiens OX=9606 GN=DAP3 PE=1 SV=1
7	G5ECE3	5.0	33.5	3102	0.028	0.009	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
8	P12111	5.1	33.5	3177	0.026	0.008	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
9	Q10195	5.1	32.3	178	0.018	0.101	YBY6_SCHPO Uncharacterized protein C11C11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11C11.06c PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15944 DUF4752	2.3e+02	13.3	Domain of unknown function (DUF4752)
2	PF11277 Med24_N	0	1387.6	Mediator complex subunit 24 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323720	0.996	Mediator of RNA polymerase II transcription subunit 14
2	9606.ENSP00000325612	0.996	Mediator of RNA polymerase II transcription subunit 16
3	9606.ENSP00000300651	0.994	Mediator of RNA polymerase II transcription subunit 1
4	9606.ENSP00000251871	0.993	Mediator of RNA polymerase II transcription subunit 17
5	9606.ENSP00000258648	0.993	Mediator of RNA polymerase II transcription subunit 4
6	9606.ENSP00000314343	0.993	Mediator of RNA polymerase II transcription subunit 29
7	9606.ENSP00000255764	0.992	Mediator of RNA polymerase II transcription subunit 10
8	9606.ENSP00000362948	0.992	Mediator of RNA polymerase II transcription subunit 18
9	9606.ENSP00000370938	0.991	Cyclin-dependent kinase 8
10	9606.ENSP00000337340	0.990	Mediator of RNA polymerase II transcription subunit 19
11	9606.ENSP00000282892	0.989	Mediator of RNA polymerase II transcription subunit 21
12	9606.ENSP00000290663	0.989	Mediator of RNA polymerase II transcription subunit 8
13	9606.ENSP00000293777	0.988	Mediator of RNA polymerase II transcription subunit 11
14	9606.ENSP00000263205	0.987	Mediator of RNA polymerase II transcription subunit 15
15	9606.ENSP00000292035	0.987	Mediator of RNA polymerase II transcription subunit 27
16	9606.ENSP00000380888	0.986	Mediator of RNA polymerase II transcription subunit 13
17	9606.ENSP00000286317	0.983	Mediator of RNA polymerase II transcription subunit 7
18	9606.ENSP00000363193	0.982	Mediator of RNA polymerase II transcription subunit 12
19	9606.ENSP00000357047	0.980	Mediator of RNA polymerase II transcription subunit 23
20	9606.ENSP00000326767	0.978	Mediator of RNA polymerase II transcription subunit 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0046966	0.999	nuclear thyroid hormone receptor binding
GO:0003824	0.364	catalytic activity
GO:0140096	0.316	catalytic activity, acting on a protein
GO:0016740	0.300	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0050794	0.967	regulation of cellular process
GO:0019222	0.963	regulation of metabolic process
GO:0048518	0.960	positive regulation of biological process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0048522	0.945	positive regulation of cellular process
GO:0006357	0.940	regulation of transcription by RNA polymerase II
GO:0051254	0.938	positive regulation of RNA metabolic process
GO:0045893	0.910	positive regulation of DNA-templated transcription
GO:1901360	0.903	organic cyclic compound metabolic process
GO:2000142	0.895	regulation of DNA-templated transcription initiation
GO:2000144	0.824	positive regulation of DNA-templated transcription initiation
GO:0034641	0.806	cellular nitrogen compound metabolic process
GO:0045944	0.806	positive regulation of transcription by RNA polymerase II
GO:0060260	0.789	regulation of transcription initiation by RNA polymerase II
GO:0046483	0.788	heterocycle metabolic process
GO:0006725	0.787	cellular aromatic compound metabolic process
GO:0006351	0.755	DNA-templated transcription
GO:1901564	0.720	organonitrogen compound metabolic process
GO:0043412	0.660	macromolecule modification
GO:0006366	0.651	transcription by RNA polymerase II
GO:0019538	0.642	protein metabolic process
GO:0036211	0.597	protein modification process
GO:0016567	0.557	protein ubiquitination
GO:0060261	0.550	positive regulation of transcription initiation by RNA polymerase II
GO:0032502	0.536	developmental process
GO:0032501	0.427	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0090575	0.951	RNA polymerase II transcription regulator complex
GO:0070847	0.935	core mediator complex
GO:0016592	0.813	mediator complex
GO:1990234	0.437	transferase complex
GO:0140535	0.417	intracellular protein-containing complex
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.300	Transferases.

[back to server]