StarFunc result for job id O75449

User Input

>input (491 residues)
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75449	1.000	1.000	3.625E-78	491	1.000	1.000	O75449.pdb.gz	KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1
2	AFDB:Q5RII9	0.647	0.654	8.042E-63	485	0.766	0.775	Q5RII9.pdb.gz	KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio OX=7955 GN=katna1 PE=2 SV=1
3	AFDB:Q9BW62	0.666	0.667	7.392E-61	490	0.674	0.676	Q9BW62.pdb.gz	KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens OX=9606 GN=KATNAL1 PE=1 SV=1
4	AFDB:A0A0B4KFL3	0.639	0.522	1.571E-52	605	0.562	0.456	A0A0B4KFL3.pdb.gz	A0A0B4KFL3_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=3 SV=1
5	AFDB:Q9SEX2	0.641	0.603	2.942E-49	523	0.519	0.488	Q9SEX2.pdb.gz	KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana OX=3702 GN=AAA1 PE=1 SV=1
6	AFDB:Q384I4	0.605	0.538	5.636E-41	554	0.434	0.384	Q384I4.pdb.gz	Q384I4_TRYB2 Katanin p60 ATPase-containing subunit A1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNA1 PE=3 SV=1
7	AFDB:Q386C7	0.586	0.509	1.373E-34	567	0.383	0.332	Q386C7.pdb.gz	Q386C7_TRYB2 Katanin p60 ATPase-containing subunit A-like 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNAL2 PE=3 SV=1
8	AFDB:E5KRP6	0.606	0.514	1.553E-32	584	0.324	0.272	E5KRP6.pdb.gz	E5KRP6_HUMAN Spastin OS=Homo sapiens OX=9606 GN=SPAST PE=3 SV=1
9	AFDB:Q57V58	0.574	0.631	1.815E-32	444	0.338	0.374	Q57V58.pdb.gz	Q57V58_TRYB2 Katanin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.340 PE=3 SV=1
10	AFDB:Q5AG40	0.566	0.631	6.318E-32	439	0.336	0.376	Q5AG40.pdb.gz	VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS4 PE=2 SV=1
11	PDB:6ugdE	0.571	0.872	2.261E-26	312	0.291	0.458	6ugdE.pdb.gz	Katanin Grips the beta-Tubulin Tail through an Electropositive Double Spiral to Sever Microtubules.
12	PDB:6ap1B	0.536	0.795	5.577E-24	322	0.287	0.438	6ap1B.pdb.gz	The AAA ATPase Vps4 binds ESCRT-III substrates through a repeating array of dipeptide-binding pockets.
13	PDB:5wc1A	0.486	0.891	2.895E-22	262	0.257	0.481	5wc1A.pdb.gz
14	PDB:2zanA	0.511	0.788	1.449E-21	312	0.257	0.404	2zanA.pdb.gz	Nucleotide-dependent conformational changes and assembly of the AAA ATPase SKD1/VPS4B
15	PDB:6opcB	0.513	0.348	4.546E-21	741	0.240	0.159	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
16	PDB:7ln6F	0.500	0.348	8.052E-21	714	0.228	0.157	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
17	PDB:7vcsA	0.504	0.327	2.485E-19	766	0.230	0.148	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
18	PDB:5l4gL	0.467	0.581	2.618E-19	389	0.218	0.275	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
19	PDB:5l4gM	0.476	0.558	3.060E-19	415	0.210	0.248	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
20	PDB:5mp9I	0.486	0.610	3.223E-19	385	0.196	0.249	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFL3	0.0	530	605	0.576	0.468	A0A0B4KFL3_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=3 SV=1
2	O75449	0.0	1018	491	1.000	1.000	KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1
3	Q5RII9	0.0	749	485	0.772	0.781	KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio OX=7955 GN=katna1 PE=2 SV=1
4	Q6E0V2	0.0	956	491	0.935	0.935	KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus OX=10116 GN=Katna1 PE=1 SV=1
5	Q8K0T4	0.0	641	488	0.678	0.682	KATL1_MOUSE Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus OX=10090 GN=Katnal1 PE=1 SV=1
6	Q8SZ40	0.0	530	572	0.576	0.495	Q8SZ40_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=2 SV=1
7	Q9BW62	0.0	644	490	0.682	0.684	KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens OX=9606 GN=KATNAL1 PE=1 SV=1
8	Q9VN89	0.0	529	572	0.576	0.495	Q9VN89_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=2 SV=2
9	Q9WV86	0.0	949	491	0.931	0.931	KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus OX=10090 GN=Katna1 PE=1 SV=1
10	Q9NHF1	2.12e-180	519	571	0.568	0.489	Q9NHF1_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=2 SV=1
11	Q9SEX2	3.99e-171	494	523	0.538	0.505	KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana OX=3702 GN=AAA1 PE=1 SV=1
12	E1JJ62	1.73e-146	434	609	0.409	0.330	E1JJ62_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=3 SV=1
13	Q961H1	2.46e-146	434	605	0.409	0.332	Q961H1_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
14	Q9VNI0	8.97e-146	434	669	0.409	0.300	Q9VNI0_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
15	Q4QPP5	1.11e-145	434	673	0.409	0.299	Q4QPP5_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
16	Q384I4	4.04e-116	354	554	0.444	0.394	Q384I4_TRYB2 Katanin p60 ATPase-containing subunit A1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNA1 PE=3 SV=1
17	Q38CB9	8.64e-108	337	680	0.356	0.257	Q38CB9_TRYB2 Katanin p60 ATPase-containing subunit A1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNA1 PE=3 SV=1
18	Q386C7	3.85e-94	298	567	0.308	0.266	Q386C7_TRYB2 Katanin p60 ATPase-containing subunit A-like 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNAL2 PE=3 SV=1
19	Q8IYT4	2.94e-89	285	538	0.303	0.277	KATL2_HUMAN Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens OX=9606 GN=KATNAL2 PE=1 SV=3
20	B9DGC0	3.06e-89	280	393	0.299	0.374	B9DGC0_ARATH AT2G34560 protein OS=Arabidopsis thaliana OX=3702 GN=CCP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	7e-36	135.0	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	25	16.3	AAA domain
3	PF13191 AAA_16	13	17.6	AAA ATPase domain
4	PF13238 AAA_18	1e+02	14.9	AAA domain
5	PF07724 AAA_2	0.03	25.9	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	3.2	19.5	AAA domain
7	PF13521 AAA_28	3.6e+02	12.8	AAA domain
8	PF13671 AAA_33	0.25	22.9	AAA domain
9	PF07728 AAA_5	0.74	21.3	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	12	16.9	P-loop containing dynein motor region
11	PF17862 AAA_lid_3	9.6e-12	55.9	AAA+ lid domain
12	PF00005 ABC_tran	2.2e+02	13.8	ABC transporter
13	PF06745 ATPase	25	15.7	KaiC
14	PF00625 Guanylate_kin	5e+02	11.8	Guanylate kinase
15	PF01695 IstB_IS21	22	16.0	IstB-like ATP binding protein
16	PF01078 Mg_chelatase	11	16.9	Magnesium chelatase, subunit ChlI
17	PF05729 NACHT	5.8e+02	11.8	NACHT domain
18	PF02562 PhoH	1.9e+02	12.9	PhoH-like protein
19	PF00910 RNA_helicase	2.1e+02	13.7	RNA helicase
20	PF05496 RuvB_N	0.043	25.0	Holliday junction DNA helicase RuvB P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368982	0.997	Katanin p80 WD40 repeat-containing subunit B1
2	9606.ENSP00000333982	0.978	Nuclear distribution protein nudE-like 1
3	9606.ENSP00000256544	0.963	KATNB1-like protein 1
4	9606.ENSP00000380378	0.955	Platelet-activating factor acetylhydrolase IB subunit alpha
5	9606.ENSP00000348965	0.925	Cytoplasmic dynein 1 heavy chain 1
6	9606.ENSP00000356056	0.902	Dynein light chain Tctex-type 1
7	9606.ENSP00000356379	0.786	Abnormal spindle-like microcephaly-associated protein
8	9606.ENSP00000359240	0.764	Leucine zipper putative tumor suppressor 2
9	9606.ENSP00000264414	0.758	Cullin-3
10	9606.ENSP00000342105	0.710	Dual specificity tyrosine-phosphorylation-regulated kinase 2
11	9606.ENSP00000280098	0.700	Speckle-type POZ protein-like
12	9606.ENSP00000377001	0.700	Speckle-type POZ protein
13	9606.ENSP00000348299	0.636	E3 ubiquitin-protein ligase TRIM13
14	9606.ENSP00000370671	0.634	Kelch-like protein 42
15	9606.ENSP00000384115	0.632	Meiosis inhibitor protein 1
16	9606.ENSP00000313752	0.630	SS nuclear autoantigen 1
17	9606.ENSP00000216911	0.623	Aurora kinase A
18	9606.ENSP00000393183	0.609	DDB1- and CUL4-associated factor 1
19	9606.ENSP00000435289	0.579	Platelet-activating factor acetylhydrolase IB subunit beta
20	9606.ENSP00000324020	0.575	Kinesin-like protein KIF15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.996	ATP-dependent activity
GO:0003824	0.996	catalytic activity
GO:0005515	0.996	protein binding
GO:0008092	0.953	cytoskeletal protein binding
GO:0140776	0.891	protein-containing complex destabilizing activity
GO:0140096	0.874	catalytic activity, acting on a protein
GO:0008568	0.477	microtubule severing ATPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.996	cellular component organization
GO:0007017	0.992	microtubule-based process
GO:0007010	0.990	cytoskeleton organization
GO:0000226	0.971	microtubule cytoskeleton organization
GO:0065007	0.605	biological regulation
GO:0050789	0.590	regulation of biological process
GO:0097435	0.585	supramolecular fiber organization
GO:0031122	0.560	cytoplasmic microtubule organization
GO:0050794	0.525	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0015630	0.984	microtubule cytoskeleton
GO:0005634	0.979	nucleus
GO:0032991	0.949	protein-containing complex
GO:0005829	0.921	cytosol
GO:0031974	0.902	membrane-enclosed lumen
GO:0070013	0.868	intracellular organelle lumen
GO:0031981	0.845	nuclear lumen
GO:0099080	0.822	supramolecular complex
GO:0005819	0.744	spindle
GO:0016020	0.706	membrane
GO:0099512	0.684	supramolecular fiber
GO:0099513	0.659	polymeric cytoskeletal fiber
GO:0005815	0.656	microtubule organizing center
GO:0005874	0.614	microtubule
GO:0071944	0.436	cell periphery
GO:0012505	0.363	endomembrane system
GO:0097431	0.343	mitotic spindle pole
GO:0042995	0.325	cell projection
GO:0005875	0.305	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.1	0.477	microtubule-severing ATPase.

[back to server]