StarFunc result for job id O75460

User Input

>input (977 residues)
MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP
VLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYMGK
KQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYF
DYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKV
MHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMV
HEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWL
LIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSR
DVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQ
KELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRASNHSLCSG
SSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPY
YFHEPPEPQPPVTPDAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K2H4	0.452	0.452	0.000	977	0.922	0.922	A0A0G2K2H4.pdb.gz	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
2	AFDB:F1QYL2	0.425	0.405	0.000	1031	0.700	0.663	F1QYL2.pdb.gz
3	AFDB:Q76MJ5	0.691	0.726	1.738E-102	926	0.480	0.506	Q76MJ5.pdb.gz	ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens OX=9606 GN=ERN2 PE=1 SV=4
4	AFDB:Q9Z2E3	0.410	0.440	1.512E-99	911	0.466	0.499	Q9Z2E3.pdb.gz	ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus OX=10090 GN=Ern2 PE=2 SV=2
5	AFDB:Q09499	0.403	0.407	4.382E-93	967	0.384	0.388	Q09499.pdb.gz	IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=2
6	AFDB:A8JR46	0.408	0.373	4.611E-86	1074	0.384	0.349	A8JR46.pdb.gz	A8JR46_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Ire1 PE=4 SV=1
7	AFDB:Q6FUI3	0.405	0.383	6.807E-62	1036	0.275	0.260	Q6FUI3.pdb.gz	Q6FUI3_CANGA non-specific serine/threonine protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IRE1 PE=4 SV=1
8	AFDB:O94537	0.399	0.365	6.906E-60	1072	0.276	0.252	O94537.pdb.gz	IRE1_SCHPO Sensor for unfolded proteins in the ER ire1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ire1 PE=1 SV=1
9	AFDB:P32361	0.391	0.344	2.791E-59	1115	0.281	0.247	P32361.pdb.gz	IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRE1 PE=1 SV=2
10	AFDB:A0A1D8PE76	0.405	0.327	1.013E-58	1223	0.288	0.230	A0A1D8PE76.pdb.gz	A0A1D8PE76_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRE1 PE=4 SV=1
11	PDB:4oauC	0.319	0.439	1.640E-18	692	0.091	0.129	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:4eomC	0.234	0.766	3.147E-17	276	0.083	0.293	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:1unlA	0.225	0.703	1.755E-16	292	0.074	0.247	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:5u6yA	0.224	0.460	3.170E-16	459	0.073	0.155	5u6yA.pdb.gz
15	PDB:7myjC	0.231	0.459	9.793E-16	465	0.095	0.200	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:4krcA	0.225	0.692	1.426E-15	297	0.075	0.246	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:4rerA	0.235	0.480	1.866E-15	459	0.096	0.205	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:2yaaA	0.235	0.722	5.178E-15	300	0.072	0.233	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
19	PDB:4zhxA	0.228	0.515	7.147E-15	409	0.080	0.191	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:3soaA	0.224	0.479	7.541E-15	436	0.067	0.149	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2H4	0.0	1771	977	0.919	0.919	A0A0G2K2H4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=2 SV=1
2	A0A8I6AJE4	0.0	1598	927	0.857	0.903	A0A8I6AJE4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=1
3	F1LSY7	0.0	1768	965	0.916	0.927	F1LSY7_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ern1 PE=4 SV=2
4	O75460	0.0	2028	977	1.000	1.000	ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens OX=9606 GN=ERN1 PE=1 SV=2
5	Q76MJ5	0.0	870	926	0.489	0.516	ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens OX=9606 GN=ERN2 PE=1 SV=4
6	Q9EQY0	0.0	1786	977	0.914	0.914	ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus OX=10090 GN=Ern1 PE=1 SV=1
7	Q9Z2E3	0.0	843	911	0.481	0.516	ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus OX=10090 GN=Ern2 PE=2 SV=2
8	Q504E3	5.82e-155	460	292	0.224	0.750	Q504E3_DANRE Endoplasmic reticulum to nucleus signaling 1 precursor OS=Danio rerio OX=7955 GN=zgc:109932 PE=2 SV=1
9	A8JR46	8.51e-150	474	1074	0.242	0.220	A8JR46_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Ire1 PE=4 SV=1
10	E5QCG0	2.18e-149	459	625	0.226	0.354	E5QCG0_CAEEL Endoribonuclease OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=1
11	Q09499	6.50e-146	461	967	0.226	0.229	IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans OX=6239 GN=ire-1 PE=1 SV=2
12	O94537	1.00e-100	342	1072	0.179	0.163	IRE1_SCHPO Sensor for unfolded proteins in the ER ire1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ire1 PE=1 SV=1
13	Q6FUI3	4.97e-98	334	1036	0.184	0.174	Q6FUI3_CANGA non-specific serine/threonine protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IRE1 PE=4 SV=1
14	P32361	1.59e-97	334	1115	0.186	0.163	IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRE1 PE=1 SV=2
15	Q4WKP8	1.17e-89	313	1165	0.190	0.160	IREA_ASPFU Serine/threonine-protein kinase/endoribonuclease ireA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ireA PE=1 SV=1
16	A0A1D8PE76	5.26e-88	309	1223	0.182	0.146	A0A1D8PE76_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRE1 PE=4 SV=1
17	Q7XIT1	2.15e-79	279	893	0.175	0.191	IRE1_ORYSJ Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Oryza sativa subsp. japonica OX=39947 GN=IRE1 PE=1 SV=1
18	Q9C5S2	1.47e-76	270	841	0.157	0.182	IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana OX=3702 GN=IRE1A PE=1 SV=1
19	Q55GJ2	1.17e-75	270	984	0.172	0.171	IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum OX=44689 GN=ireA PE=3 SV=1
20	Q93VJ2	7.13e-69	249	881	0.149	0.166	IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana OX=3702 GN=IRE1B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	1	20.8	Phosphotransferase enzyme family
2	PF09786 CytochromB561_N	66	13.9	Cytochrome B561, N terminal
3	PF06293 Kdo	3	18.7	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	2.8e-40	149.9	Protein kinase domain
5	PF17667 Pkinase_fungal	0.063	23.7	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	3e-22	90.7	Protein tyrosine and serine/threonine kinase
7	PF01011 PQQ	0.015	26.2	PQQ enzyme repeat
8	PF13360 PQQ_2	0.00016	33.0	PQQ-like domain
9	PF06479 Ribonuc_2-5A	4.9e-37	138.3	Ribonuclease 2-5A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401445

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
2	9606.ENSP00000324173	0.999	78 kDa glucose-regulated protein
3	9606.ENSP00000216037	0.997	X-box-binding protein 1
4	9606.ENSP00000389277	0.982	Bax inhibitor 1
5	9606.ENSP00000366395	0.976	E3 ubiquitin-protein ligase synoviolin
6	9606.ENSP00000351908	0.973	Mitogen-activated protein kinase kinase kinase 5
7	9606.ENSP00000376943	0.964	Bcl-2-like protein 11
8	9606.ENSP00000398698	0.957	Tumor necrosis factor
9	9606.ENSP00000426909	0.953	Receptor of activated protein C kinase 1
10	9606.ENSP00000356919	0.934	Cyclic AMP-dependent transcription factor ATF-6 alpha
11	9606.ENSP00000261601	0.911	Ubiquitin carboxyl-terminal hydrolase 14
12	9606.ENSP00000350512	0.891	COP9 signalosome complex subunit 5
13	9606.ENSP00000326366	0.887	Presenilin-1
14	9606.ENSP00000364802	0.886	Heat shock 70 kDa protein 1A
15	9606.ENSP00000335153	0.873	Heat shock protein HSP 90-alpha
16	9606.ENSP00000448665	0.873	DNA damage-inducible transcript 3 protein
17	9606.ENSP00000256383	0.861	Eukaryotic translation initiation factor 2 subunit 1
18	9606.ENSP00000243253	0.839	Protein transport protein Sec61 subunit alpha isoform 1
19	9606.ENSP00000337053	0.835	Protein sel-1 homolog 1
20	9606.ENSP00000355747	0.816	Presenilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0004674	0.992	protein serine/threonine kinase activity
GO:0046983	0.990	protein dimerization activity
GO:0042802	0.988	identical protein binding
GO:0004521	0.988	RNA endonuclease activity
GO:0097159	0.981	organic cyclic compound binding
GO:1901363	0.979	heterocyclic compound binding
GO:0031072	0.963	heat shock protein binding
GO:0097367	0.918	carbohydrate derivative binding
GO:0005524	0.905	ATP binding
GO:0051879	0.819	Hsp90 protein binding
GO:0042803	0.745	protein homodimerization activity
GO:0000287	0.374	magnesium ion binding
GO:0019899	0.328	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.981	cellular response to stimulus
GO:0006950	0.967	response to stress
GO:0050789	0.965	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0070887	0.954	cellular response to chemical stimulus
GO:0010033	0.951	response to organic substance
GO:0019222	0.944	regulation of metabolic process
GO:0008152	0.937	metabolic process
GO:0071310	0.937	cellular response to organic substance
GO:0048518	0.933	positive regulation of biological process
GO:0060255	0.910	regulation of macromolecule metabolic process
GO:0033554	0.910	cellular response to stress
GO:0071704	0.898	organic substance metabolic process
GO:0044238	0.894	primary metabolic process
GO:0080090	0.894	regulation of primary metabolic process
GO:0031323	0.894	regulation of cellular metabolic process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0006807	0.849	nitrogen compound metabolic process
GO:0044237	0.817	cellular metabolic process
GO:0051246	0.807	regulation of protein metabolic process
GO:0043170	0.804	macromolecule metabolic process
GO:1901701	0.791	cellular response to oxygen-containing compound
GO:0048522	0.778	positive regulation of cellular process
GO:0042593	0.678	glucose homeostasis
GO:0048583	0.674	regulation of response to stimulus
GO:0071333	0.669	cellular response to glucose stimulus
GO:0009966	0.648	regulation of signal transduction
GO:0051173	0.636	positive regulation of nitrogen compound metabolic process
GO:0010604	0.633	positive regulation of macromolecule metabolic process
GO:0065009	0.625	regulation of molecular function
GO:0031325	0.622	positive regulation of cellular metabolic process
GO:0070301	0.614	cellular response to hydrogen peroxide
GO:0048519	0.560	negative regulation of biological process
GO:0007154	0.556	cell communication
GO:1901564	0.554	organonitrogen compound metabolic process
GO:0023052	0.544	signaling
GO:0019538	0.544	protein metabolic process
GO:0051247	0.517	positive regulation of protein metabolic process
GO:0044093	0.515	positive regulation of molecular function
GO:0034976	0.488	response to endoplasmic reticulum stress
GO:0045860	0.483	positive regulation of protein kinase activity
GO:1902531	0.481	regulation of intracellular signal transduction
GO:0048584	0.478	positive regulation of response to stimulus
GO:0009967	0.473	positive regulation of signal transduction
GO:0048523	0.466	negative regulation of cellular process
GO:0007165	0.462	signal transduction
GO:0071900	0.457	regulation of protein serine/threonine kinase activity
GO:0010468	0.454	regulation of gene expression
GO:0043410	0.444	positive regulation of MAPK cascade
GO:0019219	0.442	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.436	regulation of biosynthetic process
GO:0071902	0.433	positive regulation of protein serine/threonine kinase activity
GO:0010556	0.427	regulation of macromolecule biosynthetic process
GO:1901360	0.425	organic cyclic compound metabolic process
GO:0034641	0.425	cellular nitrogen compound metabolic process
GO:0031326	0.415	regulation of cellular biosynthetic process
GO:0090305	0.413	nucleic acid phosphodiester bond hydrolysis
GO:0043506	0.411	regulation of JUN kinase activity
GO:0043406	0.386	positive regulation of MAP kinase activity
GO:0036211	0.322	protein modification process
GO:0034620	0.321	cellular response to unfolded protein
GO:0080134	0.319	regulation of response to stress
GO:0051252	0.319	regulation of RNA metabolic process
GO:0009892	0.301	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0005634	0.973	nucleus
GO:0005829	0.879	cytosol
GO:0140534	0.577	endoplasmic reticulum protein-containing complex
GO:0098796	0.486	membrane protein complex
GO:0070013	0.341	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.992	Phosphotransferases with an alcohol group as acceptor.
EC:3.1.-.-	0.990	Acting on ester bonds.

[back to server]