StarFunc result for job id O75461

User Input

>input (281 residues)
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3K8	0.616	0.616	4.045E-42	281	1.000	1.000	A0A0S2Z3K8.pdb.gz	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
2	AFDB:O54917	0.572	0.589	5.437E-40	272	0.843	0.871	O54917.pdb.gz	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
3	AFDB:P56931	0.478	0.322	1.138E-22	443	0.370	0.235	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
4	AFDB:Q14209	0.459	0.314	1.210E-22	437	0.402	0.259	Q14209.pdb.gz	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
5	AFDB:O00716	0.553	0.351	2.925E-21	465	0.423	0.256	O00716.pdb.gz	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
6	AFDB:O09139	0.497	0.337	5.208E-20	432	0.367	0.238	O09139.pdb.gz	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
7	AFDB:Q9FV71	0.505	0.321	7.074E-20	469	0.356	0.213	Q9FV71.pdb.gz	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
8	AFDB:Q01094	0.492	0.332	7.996E-20	437	0.374	0.240	Q01094.pdb.gz	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
9	AFDB:Q9FNY0	0.487	0.301	1.228E-19	485	0.352	0.204	Q9FNY0.pdb.gz	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
10	AFDB:Q9FV70	0.531	0.389	1.819E-18	396	0.335	0.237	Q9FV70.pdb.gz	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
11	PDB:4fx0B	0.181	0.334	2.940E-2	135	0.057	0.119	4fx0B.pdb.gz
12	PDB:4ev0D	0.210	0.266	4.799E-2	214	0.036	0.047	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
13	PDB:5l4kO	0.208	0.161	4.799E-2	376	0.046	0.035	5l4kO.pdb.gz
14	PDB:5hs7A	0.173	0.402	5.767E-2	102	0.039	0.108	5hs7A.pdb.gz
15	PDB:1tw2B	0.136	0.112	6.132E-2	350	0.050	0.040	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
16	PDB:5v8f4	0.212	0.085	6.132E-2	741	0.036	0.013	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
17	PDB:6fvtR	0.188	0.134	7.834E-2	405	0.043	0.030	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
18	PDB:6jmiA	0.197	0.488	7.834E-2	100	0.046	0.130	6jmiA.pdb.gz
19	PDB:4zzlA	0.180	0.322	1.064E-1	146	0.071	0.137	4zzlA.pdb.gz
20	PDB:5l4kR	0.189	0.140	1.064E-1	389	0.039	0.028	5l4kR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3K8	0.0	575	281	1.000	1.000	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
2	O75461	0.0	575	281	1.000	1.000	E2F6_HUMAN Transcription factor E2F6 OS=Homo sapiens OX=9606 GN=E2F6 PE=1 SV=1
3	O54917	1.13e-177	492	272	0.843	0.871	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
4	Q53YM3	2.31e-151	423	206	0.733	1.000	Q53YM3_HUMAN E2F transcription factor 6, isoform CRA_d OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
5	O35261	2.20e-57	192	457	0.345	0.212	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
6	O00716	4.05e-57	191	465	0.345	0.209	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
7	Q14209	4.13e-56	188	437	0.338	0.217	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
8	P56931	5.50e-55	185	443	0.335	0.212	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
9	Q01094	2.20e-44	157	437	0.342	0.220	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
10	Q9FV71	7.95e-44	157	469	0.302	0.181	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
11	Q9FNY0	1.58e-41	150	485	0.317	0.184	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
12	Q61501	1.74e-39	144	430	0.327	0.214	E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus OX=10090 GN=E2f1 PE=1 SV=1
13	O09139	2.29e-39	144	432	0.327	0.213	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
14	Q9FV70	3.71e-39	142	396	0.299	0.212	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
15	Q61502	5.78e-33	125	335	0.267	0.224	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2
16	Q6DE14	8.64e-33	125	375	0.270	0.203	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
17	F4ILT1	1.25e-32	127	514	0.295	0.161	F4ILT1_ARATH E2F transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=E2F3 PE=1 SV=1
18	Q15329	3.68e-32	123	346	0.260	0.211	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
19	Q62814	7.55e-32	121	300	0.260	0.243	E2F5_RAT Transcription factor E2F5 (Fragment) OS=Rattus norvegicus OX=10116 GN=E2f5 PE=2 SV=1
20	Q27368	1.92e-31	125	805	0.267	0.093	E2F1_DROME Transcription factor E2f1 OS=Drosophila melanogaster OX=7227 GN=E2f1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09104 BRCA-2_OB3	1e+02	13.9	BRCA2, oligonucleotide/oligosaccharide-binding, domain 3
2	PF18986 DUF5719	4.2e+02	11.4	Family of unknown function (DUF5719)
3	PF16421 E2F_CC-MB	1.2e-29	113.7	E2F transcription factor CC-MB domain
4	PF02319 E2F_TDP	2e-22	90.1	E2F/DP family winged-helix DNA-binding domain
5	PF01978 TrmB	58	15.0	Sugar-specific transcriptional regulator TrmB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356480	0.998	E3 ubiquitin-protein ligase RING2
2	9606.ENSP00000364519	0.997	Transcription factor Dp-1
3	9606.ENSP00000419494	0.997	RING1 and YY1-binding protein
4	9606.ENSP00000216237	0.993	Lethal(3)malignant brain tumor-like protein 2
5	9606.ENSP00000219905	0.991	MAX gene-associated protein
6	9606.ENSP00000320147	0.990	Histone-lysine N-methyltransferase EZH2
7	9606.ENSP00000358862	0.990	Polycomb group RING finger protein 6
8	9606.ENSP00000336687	0.987	Chromobox protein homolog 3
9	9606.ENSP00000351446	0.987	WD repeat-containing protein 5
10	9606.ENSP00000351490	0.956	Protein max
11	9606.ENSP00000418960	0.956	Breast cancer type 1 susceptibility protein
12	9606.ENSP00000420616	0.954	Transcription factor Dp-2
13	9606.ENSP00000363787	0.953	E3 ubiquitin-protein ligase RING1
14	9606.ENSP00000388648	0.941	Serine/threonine-protein kinase Chk1
15	9606.ENSP00000328004	0.940	YY1 associated factor 2, isoform CRA_d
16	9606.ENSP00000406549	0.940	Transcription initiation factor TFIID subunit 1
17	9606.ENSP00000448165	0.934	Apoptotic protease-activating factor 1
18	9606.ENSP00000353770	0.933	Ribonucleoside-diphosphate reductase subunit M2
19	9606.ENSP00000393139	0.930	Cell division cycle 7-related protein kinase
20	9606.ENSP00000382628	0.928	DNA endonuclease RBBP8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0043565	1.000	sequence-specific DNA binding
GO:1990837	0.966	sequence-specific double-stranded DNA binding
GO:0000976	0.945	transcription cis-regulatory region binding
GO:0000977	0.660	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0048523	0.988	negative regulation of cellular process
GO:0009987	0.963	cellular process
GO:0006357	0.843	regulation of transcription by RNA polymerase II
GO:0009892	0.839	negative regulation of metabolic process
GO:0045934	0.828	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.812	negative regulation of macromolecule metabolic process
GO:0010558	0.789	negative regulation of macromolecule biosynthetic process
GO:0031327	0.788	negative regulation of cellular biosynthetic process
GO:1902679	0.764	negative regulation of RNA biosynthetic process
GO:0045892	0.680	negative regulation of DNA-templated transcription
GO:0000122	0.314	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.977	protein-containing complex
GO:0140513	0.810	nuclear protein-containing complex
GO:0043232	0.802	intracellular non-membrane-bounded organelle
GO:1990234	0.706	transferase complex
GO:0005737	0.601	cytoplasm
GO:0035097	0.426	histone methyltransferase complex
GO:0005694	0.399	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]