StarFunc result for job id O75462

User Input

>input (422 residues)
MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC
SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD
GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ
DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPD
VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG
LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS
GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP
AR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JM58	0.915	0.909	4.619E-76	425	0.953	0.946	Q9JM58.pdb.gz	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
2	AFDB:P40190	0.518	0.262	1.876E-24	918	0.206	0.095	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
3	AFDB:Q00560	0.515	0.261	2.700E-24	917	0.213	0.098	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
4	AFDB:P40189	0.485	0.249	2.953E-23	918	0.204	0.094	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
5	AFDB:A4JYQ0	0.526	0.610	4.648E-22	357	0.213	0.252	A4JYQ0.pdb.gz	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
6	AFDB:O88507	0.538	0.602	5.723E-22	372	0.220	0.250	O88507.pdb.gz	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
7	AFDB:Q14626	0.453	0.453	8.676E-22	422	0.192	0.192	Q14626.pdb.gz	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
8	AFDB:P08887	0.459	0.422	3.533E-21	468	0.201	0.182	P08887.pdb.gz	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
9	AFDB:Q64385	0.444	0.435	1.296E-20	432	0.192	0.188	Q64385.pdb.gz	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
10	AFDB:A8WH79	0.444	0.248	1.515E-20	866	0.209	0.102	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
11	PDB:7u7nC	0.384	0.755	1.451E-13	200	0.135	0.285	7u7nC.pdb.gz
12	PDB:7z0lB	0.369	0.417	2.169E-12	370	0.152	0.173	7z0lB.pdb.gz
13	PDB:5mj3A	0.325	0.439	2.921E-11	302	0.133	0.185	5mj3A.pdb.gz
14	PDB:8eyyA	0.232	0.148	1.521E-9	775	0.128	0.070	8eyyA.pdb.gz
15	PDB:6pxvA	0.213	0.119	4.242E-8	823	0.109	0.056	6pxvA.pdb.gz
16	PDB:8dtlA	0.229	0.150	4.468E-8	741	0.118	0.067	8dtlA.pdb.gz
17	PDB:1e07A	0.241	0.178	2.127E-7	642	0.107	0.070	1e07A.pdb.gz
18	PDB:6pyhD	0.209	0.123	2.758E-7	798	0.118	0.063	6pyhD.pdb.gz
19	PDB:6dldD	0.259	0.370	3.061E-7	269	0.109	0.171	6dldD.pdb.gz
20	PDB:5oj2B	0.252	0.180	4.640E-7	692	0.121	0.074	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75462	0.0	865	422	1.000	1.000	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
2	Q9JM58	0.0	810	425	0.948	0.941	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
3	Q17RA0	1.21e-29	124	918	0.206	0.095	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
4	P40189	1.28e-29	124	918	0.206	0.095	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
5	Q00560	9.44e-28	118	917	0.218	0.100	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
6	P16471	9.59e-28	117	622	0.190	0.129	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
7	P40190	1.42e-27	117	918	0.213	0.098	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
8	F1N4H8	6.87e-27	111	296	0.173	0.247	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
9	P05710	1.41e-26	114	610	0.182	0.126	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2
10	Q90374	5.84e-26	112	830	0.180	0.092	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
11	Q08501	1.13e-25	111	608	0.185	0.128	PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 GN=Prlr PE=1 SV=1
12	Q28172	3.96e-25	110	581	0.171	0.124	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
13	Q04594	7.34e-25	109	831	0.178	0.090	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
14	Q2PBN9	3.59e-24	107	581	0.168	0.122	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
15	F1RCZ2	2.64e-22	102	859	0.237	0.116	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
16	A8WH79	5.06e-22	101	866	0.242	0.118	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
17	Q8NI17	7.54e-17	85.1	732	0.149	0.086	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
18	Q2VBQ8	1.95e-16	83.6	509	0.161	0.134	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
19	P40223	5.91e-16	82.4	837	0.225	0.114	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
20	Q9DE08	9.52e-16	81.6	638	0.168	0.111	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	4.4e-10	51.0	Erythropoietin receptor, ligand binding
2	PF00041 fn3	6.1e-11	53.8	Fibronectin type III domain
3	PF13895 Ig_2	5.4e+02	12.3	Immunoglobulin domain
4	PF13927 Ig_3	2.6e+02	13.6	Immunoglobulin domain
5	PF09240 IL6Ra-bind	0.00072	31.3	Interleukin-6 receptor alpha chain, binding
6	PF09294 Interfer-bind	56	15.4	Interferon-alpha/beta receptor, fibronectin type III
7	PF06328 Lep_receptor_Ig	0.098	24.0	Ig-like C2-type domain
8	PF18589 ObR_Ig	1.3	20.8	Obesity receptor immunoglobulin like domain
9	PF16656 Pur_ac_phosph_N	0.0072	28.3	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309338	0.999	Cardiotrophin-like cytokine factor 1
2	9606.ENSP00000349365	0.992	Interleukin-27 subunit alpha
3	9606.ENSP00000368265	0.902	Ciliary neurotrophic factor receptor subunit alpha
4	9606.ENSP00000355370	0.832	Ciliary neurotrophic factor
5	9606.ENSP00000351422	0.826	Uncharacterized protein C19orf60
6	9606.ENSP00000398688	0.723	Von Willebrand factor A domain containing 5B2
7	9606.ENSP00000260197	0.705	Sortilin-related receptor
8	9606.ENSP00000263409	0.704	Leukemia inhibitory factor receptor
9	9606.ENSP00000253193	0.699	Low-density lipoprotein receptor-related protein 3
10	9606.ENSP00000371067	0.699	Tyrosine-protein kinase JAK2
11	9606.ENSP00000343204	0.677	Tyrosine-protein kinase JAK1
12	9606.ENSP00000431885	0.657	Non-receptor tyrosine-protein kinase TYK2
13	9606.ENSP00000263379	0.646	Interleukin-27 receptor subunit alpha
14	9606.ENSP00000368716	0.620	N-alpha-acetyltransferase 16, NatA auxiliary subunit
15	9606.ENSP00000370698	0.619	Interleukin-6 receptor subunit beta
16	9606.ENSP00000430307	0.587	Protease, serine, 46
17	9606.ENSP00000339867	0.544	Chloride channel protein 1
18	9606.ENSP00000450456	0.524	Retina and anterior neural fold homeobox protein 2
19	9606.ENSP00000360973	0.500	Type-2 angiotensin II receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	0.998	cytokine receptor binding
GO:0004888	0.887	transmembrane signaling receptor activity
GO:0019955	0.538	cytokine binding
GO:0004896	0.441	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0043523	0.990	regulation of neuron apoptotic process
GO:0048523	0.977	negative regulation of cellular process
GO:0043524	0.951	negative regulation of neuron apoptotic process
GO:0010604	0.948	positive regulation of macromolecule metabolic process
GO:0050730	0.928	regulation of peptidyl-tyrosine phosphorylation
GO:0048522	0.923	positive regulation of cellular process
GO:0042509	0.910	regulation of tyrosine phosphorylation of STAT protein
GO:0045937	0.864	positive regulation of phosphate metabolic process
GO:0042327	0.846	positive regulation of phosphorylation
GO:0051247	0.844	positive regulation of protein metabolic process
GO:0008284	0.840	positive regulation of cell population proliferation
GO:0032501	0.839	multicellular organismal process
GO:0009987	0.826	cellular process
GO:0048856	0.809	anatomical structure development
GO:0001934	0.803	positive regulation of protein phosphorylation
GO:0050731	0.649	positive regulation of peptidyl-tyrosine phosphorylation
GO:0050896	0.612	response to stimulus
GO:0051716	0.490	cellular response to stimulus
GO:0007275	0.480	multicellular organism development
GO:0042531	0.446	positive regulation of tyrosine phosphorylation of STAT protein
GO:0042221	0.418	response to chemical
GO:0023052	0.409	signaling
GO:0010033	0.393	response to organic substance
GO:0048731	0.351	system development
GO:0007154	0.347	cell communication
GO:0007165	0.334	signal transduction
GO:0010468	0.301	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005615	0.998	extracellular space
GO:0005829	0.993	cytosol
GO:0016020	0.584	membrane
GO:0043226	0.455	organelle
GO:0043227	0.454	membrane-bounded organelle
GO:0071944	0.413	cell periphery
GO:0005886	0.322	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]