StarFunc result for job id O75467

User Input

>input (553 residues)
MAFEDVAVYFSQEEWGLLDTAQRALYRRVMLDNFALVASLGLSTSRPRVVIQLERGEEPW
VPSGTDTTLSRTTYRRRNPGSWSLTEDRDVSGEWPRAFPDTPPGMTTSVFPVAGACHSVK
SLQRQRGASPSRERKPTGVSVIYWERLLLGSGSGQASVSLRLTSPLRPPEGVRLREKTLT
EHALLGRQPRTPERQKPCAQEVPGRTFGSAQDLEAAGGRGHHRMGAVWQEPHRLLGGQEP
STWDELGEALHAGEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHL
TQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHR
KIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHT
GEKPFACPQCGRAFSHSSNLTQHQLLHTGERPFRCVDCGKAFAKGAVLLSHRRIHTGEKP
FVCTQCGRAFRERPALFHHQRIHTGEKTVRRSRASLHPQARSVAGASSEGAPAKETEPTP
ASGPAAVSQPAEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75467	1.000	1.000	5.756E-85	553	1.000	1.000	O75467.pdb.gz	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
2	AFDB:P21506	0.442	0.427	3.218E-40	573	0.349	0.337	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
3	AFDB:Q06732	0.403	0.295	5.382E-40	778	0.353	0.251	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
4	AFDB:Q3KQV3	0.406	0.358	2.518E-39	632	0.387	0.339	Q3KQV3.pdb.gz	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
5	AFDB:Q16587	0.374	0.328	3.351E-39	644	0.371	0.318	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
6	AFDB:A0A024R4S7	0.408	0.293	1.660E-38	792	0.356	0.249	A0A024R4S7.pdb.gz
7	AFDB:Q80V81	0.415	0.383	1.937E-37	607	0.342	0.311	Q80V81.pdb.gz	Q80V81_MOUSE Zinc finger protein 819 OS=Mus musculus OX=10090 GN=Zfp819 PE=1 SV=1
8	AFDB:E9PYI1	0.321	0.269	8.085E-37	671	0.347	0.286	E9PYI1.pdb.gz	ZN568_MOUSE Zinc finger protein 568 OS=Mus musculus OX=10090 GN=Znf568 PE=1 SV=1
9	AFDB:P51523	0.406	0.317	2.262E-36	738	0.336	0.252	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	AFDB:A0A0A0MS50	0.416	0.384	6.698E-36	604	0.365	0.334	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
11	PDB:3w5kB	0.088	0.269	6.319E-4	110	0.072	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.041	0.144	7.134E-1	96	0.029	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:6g90T	0.056	0.065	7.553E-1	462	0.054	0.065	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:7ad8D	0.039	0.063	9.493E-1	280	0.045	0.089	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:7o4iW	0.047	0.071	1.193	312	0.067	0.119	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:5c8dE	0.076	0.113	1.416	280	0.042	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:6ydhA	0.034	0.214	1.780	62	0.018	0.161	6ydhA.pdb.gz
18	PDB:4wlwA	0.060	0.150	1.885	130	0.036	0.154	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
19	PDB:5lj5t	0.043	0.051	2.369	438	0.036	0.046	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
20	PDB:6o9lQ	0.056	0.068	2.656	430	0.083	0.107	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75467	0.0	1125	553	1.000	1.000	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
2	A0A0C4DG42	6.92e-130	392	539	0.396	0.406	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
3	Q8IZ26	1.24e-129	392	560	0.396	0.391	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
4	Q96HQ0	6.36e-129	388	510	0.382	0.414	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
5	Q8NA42	3.81e-126	380	475	0.371	0.432	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
6	P15622	6.14e-124	377	560	0.389	0.384	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
7	Q68DY9	4.88e-120	364	489	0.367	0.415	ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens OX=9606 GN=ZNF772 PE=1 SV=2
8	P52742	4.63e-119	367	658	0.410	0.345	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q3KQV3	2.46e-118	365	632	0.374	0.328	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
10	Q8TAQ5	8.35e-118	365	688	0.378	0.304	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	Q8TAF7	1.78e-116	358	563	0.391	0.384	ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens OX=9606 GN=ZNF461 PE=1 SV=2
12	Q86Y25	2.45e-116	357	554	0.373	0.372	Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens OX=9606 GN=ZNF354C PE=1 SV=1
13	Q03923	9.75e-116	357	595	0.351	0.326	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
14	Q8WV37	1.71e-115	354	535	0.353	0.364	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
15	Q8TD23	3.49e-115	355	568	0.363	0.354	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
16	Q08ER8	7.84e-115	355	600	0.380	0.350	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
17	Q96JC4	9.61e-115	352	524	0.354	0.374	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
18	Q8N9F8	2.33e-114	351	522	0.367	0.389	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
19	Q6ECI4	3.64e-114	357	717	0.358	0.276	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
20	P35789	5.25e-114	353	620	0.353	0.315	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	19	17.0	BolA-like protein
2	PF07975 C1_4	1.3	20.6	TFIIH C1-like domain
3	PF12773 DZR	24	16.3	Double zinc ribbon
4	PF09538 FYDLN_acid	13	17.9	Protein of unknown function (FYDLN_acid)
5	PF09237 GAGA	2.2	19.7	GAGA factor
6	PF07754 HVO_2753_ZBP	8.8e+02	11.1	Small zinc finger protein HVO_2753-like, Zn-binding pocket
7	PF01155 HypA	5.3	18.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
8	PF01352 KRAB	6.4e-18	75.4	KRAB box
9	PF00412 LIM	3.5	19.2	LIM domain
10	PF03966 Trm112p	3.9e+02	13.0	Trm112p-like protein
11	PF00096 zf-C2H2	1.1e-43	156.4	Zinc finger, C2H2 type
12	PF16622 zf-C2H2_11	1.4	20.1	zinc-finger C2H2-type
13	PF13894 zf-C2H2_4	2.1e-24	95.1	C2H2-type zinc finger
14	PF13912 zf-C2H2_6	1.4e-07	42.6	C2H2-type zinc finger
15	PF12171 zf-C2H2_jaz	1.5e-07	42.7	Zinc-finger double-stranded RNA-binding
16	PF13913 zf-C2HC_2	1.1e+02	14.1	zinc-finger of a C2HC-type
17	PF05605 zf-Di19	59	15.4	Drought induced 19 protein (Di19), zinc-binding
18	PF13465 zf-H2C2_2	8.6e-64	220.6	Zinc-finger double domain
19	PF18439 zf_UBZ	0.032	25.2	Ubiquitin-Binding Zinc Finger
20	PF17032 zinc_ribbon_15	0.21	23.7	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439856	0.572	Calcium homeostasis endoplasmic reticulum protein
2	9606.ENSP00000292140	0.562	Pleckstrin homology like domain family B member 3
3	9606.ENSP00000312439	0.526	E3 ubiquitin-protein ligase RNF26
4	9606.ENSP00000419475	0.520	COMM domain-containing protein 2
5	9606.ENSP00000370055	0.504	Ubiquitin-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.544	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0050789	0.829	regulation of biological process
GO:0010468	0.775	regulation of gene expression
GO:0050794	0.770	regulation of cellular process
GO:0010556	0.723	regulation of macromolecule biosynthetic process
GO:0031326	0.722	regulation of cellular biosynthetic process
GO:0051171	0.710	regulation of nitrogen compound metabolic process
GO:0080090	0.703	regulation of primary metabolic process
GO:0051252	0.597	regulation of RNA metabolic process
GO:0044843	0.582	cell cycle G1/S phase transition
GO:0006355	0.522	regulation of DNA-templated transcription
GO:0000082	0.439	G1/S transition of mitotic cell cycle
GO:0048519	0.350	negative regulation of biological process
GO:0048518	0.308	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.444	cytoplasm
GO:0016020	0.395	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]