StarFunc result for job id O75469

User Input

>input (434 residues)
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8P9	0.686	0.630	3.534E-63	473	0.998	0.915	F1D8P9.pdb.gz	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
2	AFDB:A5J0K7	0.650	0.669	3.999E-52	421	0.832	0.857	A5J0K7.pdb.gz	A5J0K7_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
3	AFDB:H0Y8E2	0.565	0.615	7.079E-51	397	0.910	0.995	H0Y8E2.pdb.gz	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
4	AFDB:O54915	0.785	0.790	1.171E-48	431	0.765	0.770	O54915.pdb.gz	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
5	AFDB:A0A3G3LJZ1	0.677	0.682	2.411E-31	431	0.475	0.478	A0A3G3LJZ1.pdb.gz
6	AFDB:Q9DFH3	0.504	0.557	1.164E-29	391	0.438	0.486	Q9DFH3.pdb.gz	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
7	AFDB:Q9PTN2	0.497	0.477	8.475E-28	453	0.396	0.380	Q9PTN2.pdb.gz	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2
8	AFDB:Q1L673	0.497	0.511	2.110E-27	422	0.399	0.410	Q1L673.pdb.gz	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
9	AFDB:F1D8P8	0.503	0.511	2.533E-27	427	0.380	0.386	F1D8P8.pdb.gz	F1D8P8_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=NR1i1 PE=2 SV=1
10	AFDB:O42392	0.508	0.489	5.499E-27	451	0.396	0.381	O42392.pdb.gz	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1
11	PDB:3dzyA	0.368	0.515	1.796E-11	302	0.200	0.288	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.413	0.726	1.167E-8	238	0.150	0.273	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.339	0.576	1.197E-5	246	0.113	0.199	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.386	0.622	8.909E-5	259	0.088	0.147	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7a6hO	0.086	0.076	7.797E-1	512	0.081	0.068	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:3f29B	0.101	0.089	8.542E-1	520	0.078	0.065	3f29B.pdb.gz	Binding of sulfite by the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase
17	PDB:3axjB	0.115	0.163	1.073	240	0.060	0.108	3axjB.pdb.gz
18	PDB:6wpwR	0.103	0.111	1.123	398	0.092	0.101	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
19	PDB:4alyA	0.110	0.179	1.348	211	0.065	0.133	4alyA.pdb.gz
20	PDB:3ipmO	0.097	0.153	1.411	219	0.067	0.132	3ipmO.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5J0K7	0.0	757	421	0.832	0.857	A5J0K7_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
2	F1D8P9	0.0	906	473	0.998	0.915	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
3	H0Y8E2	0.0	811	397	0.912	0.997	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
4	J3KPQ3	0.0	904	434	0.998	0.998	J3KPQ3_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
5	O54915	0.0	701	431	0.765	0.770	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
6	O75469	0.0	905	434	1.000	1.000	NR1I2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
7	Q2V0W2	0.0	755	421	0.829	0.855	Q2V0W2_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
8	Q9R1A7	0.0	696	431	0.760	0.766	NR1I2_RAT Nuclear receptor subfamily 1 group I member 2 OS=Rattus norvegicus OX=10116 GN=Nr1i2 PE=2 SV=1
9	B0V1H8	1.08e-130	385	430	0.477	0.481	B0V1H8_DANRE Nuclear receptor subfamily 1 group I member 2 isoform X1 OS=Danio rerio OX=7955 GN=PXR PE=3 SV=1
10	A5WYG8	2.57e-129	382	430	0.475	0.479	A5WYG8_DANRE Nuclear receptor subfamily 1 group I member 2 OS=Danio rerio OX=7955 GN=PXR PE=2 SV=1
11	Q9DFH3	2.19e-107	324	391	0.422	0.468	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
12	Q1L673	7.35e-106	322	422	0.415	0.427	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
13	O42392	4.55e-103	315	451	0.412	0.397	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1
14	P13053	1.01e-101	311	423	0.396	0.407	VDR_RAT Vitamin D3 receptor OS=Rattus norvegicus OX=10116 GN=Vdr PE=1 SV=1
15	Q9PTN2	3.44e-101	310	453	0.406	0.389	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2
16	P48281	4.04e-100	307	422	0.396	0.408	VDR_MOUSE Vitamin D3 receptor OS=Mus musculus OX=10090 GN=Vdr PE=1 SV=2
17	F1D8P8	1.56e-98	303	427	0.401	0.407	F1D8P8_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=NR1i1 PE=2 SV=1
18	P11473	1.56e-98	303	427	0.401	0.407	VDR_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=VDR PE=1 SV=1
19	A0A5K1VW50	3.41e-97	301	494	0.401	0.352	A0A5K1VW50_HUMAN Vitamin D3 receptor OS=Homo sapiens OX=9606 GN=VDR PE=1 SV=1
20	Q14994	8.94e-95	291	352	0.378	0.466	NR1I3_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	9.5e-14	63.0	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	3.5e-24	96.4	Zinc finger, C4 type (two domains)
3	PF17026 zf-RRPl_C4	6e+02	12.0	Putative ribonucleoprotein zinc-finger pf C4 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
2	9606.ENSP00000384018	0.989	Nuclear receptor corepressor 2
3	9606.ENSP00000419692	0.984	Retinoic acid receptor RXR-alpha
4	9606.ENSP00000264867	0.982	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
5	9606.ENSP00000268712	0.959	Nuclear receptor corepressor 1
6	9606.ENSP00000348056	0.928	SUMO-conjugating enzyme UBC9
7	9606.ENSP00000409666	0.917	Small ubiquitin-like modifier 3
8	9606.ENSP00000337915	0.906	Cytochrome P450 3A4
9	9606.ENSP00000400341	0.904	Hepatocyte nuclear factor 3-beta
10	9606.ENSP00000254227	0.866	Nuclear receptor subfamily 0 group B member 2
11	9606.ENSP00000355890	0.857	Bifunctional glutamate/proline--tRNA ligase
12	9606.ENSP00000324648	0.847	Cytochrome P450 2B6
13	9606.ENSP00000242057	0.839	Aryl hydrocarbon receptor
14	9606.ENSP00000221132	0.808	Tumor necrosis factor receptor superfamily member 10A
15	9606.ENSP00000260970	0.807	Peptidyl-prolyl cis-trans isomerase G
16	9606.ENSP00000362680	0.789	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000427514	0.784	CCAAT/enhancer-binding protein alpha
18	9606.ENSP00000304845	0.781	UDP-glucuronosyltransferase 1-1
19	9606.ENSP00000260682	0.769	Cytochrome P450 2C9
20	9606.ENSP00000222982	0.755	Cytochrome P450 3A5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0004879	0.994	nuclear receptor activity
GO:0043565	0.975	sequence-specific DNA binding
GO:0003690	0.906	double-stranded DNA binding
GO:0001067	0.903	transcription regulatory region nucleic acid binding
GO:1990837	0.799	sequence-specific double-stranded DNA binding
GO:0000976	0.644	transcription cis-regulatory region binding
GO:0036094	0.481	small molecule binding
GO:0000977	0.423	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008289	0.378	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0050789	0.989	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0019222	0.955	regulation of metabolic process
GO:0042221	0.938	response to chemical
GO:0080090	0.921	regulation of primary metabolic process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0051171	0.908	regulation of nitrogen compound metabolic process
GO:0010556	0.906	regulation of macromolecule biosynthetic process
GO:0031326	0.903	regulation of cellular biosynthetic process
GO:0051252	0.898	regulation of RNA metabolic process
GO:0048518	0.893	positive regulation of biological process
GO:0006355	0.889	regulation of DNA-templated transcription
GO:0010604	0.848	positive regulation of macromolecule metabolic process
GO:0008152	0.826	metabolic process
GO:0048522	0.791	positive regulation of cellular process
GO:0051173	0.760	positive regulation of nitrogen compound metabolic process
GO:0071704	0.693	organic substance metabolic process
GO:0051716	0.586	cellular response to stimulus
GO:0044237	0.577	cellular metabolic process
GO:0044238	0.450	primary metabolic process
GO:0070887	0.446	cellular response to chemical stimulus
GO:0009891	0.343	positive regulation of biosynthetic process
GO:0031325	0.329	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0045111	0.784	intermediate filament cytoskeleton
GO:0005737	0.770	cytoplasm
GO:0016020	0.510	membrane
GO:0032991	0.347	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]