StarFunc result for job id O75475

User Input

>input (530 residues)
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75475	0.999	0.999	2.198E-73	530	1.000	1.000	O75475.pdb.gz	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
2	AFDB:Q5XXA9	0.349	0.322	4.331E-54	579	0.757	0.693	Q5XXA9.pdb.gz	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
3	AFDB:Q3UMU9	0.197	0.160	1.062E-27	669	0.351	0.278	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
4	AFDB:Q7Z4V5	0.179	0.148	1.329E-26	671	0.321	0.253	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
5	AFDB:A0A024R216	0.173	0.450	1.510E-16	203	0.166	0.433	A0A024R216.pdb.gz
6	AFDB:Q5FVD1	0.172	0.448	5.835E-16	201	0.158	0.418	Q5FVD1.pdb.gz	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
7	AFDB:P51859	0.176	0.388	1.890E-15	237	0.172	0.384	P51859.pdb.gz	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
8	AFDB:A0A384NPW1	0.177	0.381	3.025E-15	240	0.175	0.388	A0A384NPW1.pdb.gz	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	PDB:6s01K	0.155	0.858	8.789E-12	86	0.162	1.000	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
10	AFDB:Q9LEY4	0.151	0.057	2.590E-6	1445	0.113	0.042	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
11	AFDB:F4IN78	0.148	0.060	3.056E-5	1366	0.130	0.051	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
12	PDB:7e29A	0.123	0.132	4.988E-3	496	0.040	0.042	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
13	PDB:4v8mBa	0.067	0.245	1.695E-1	132	0.023	0.091	4v8mBa.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
14	PDB:3mp8A	0.085	0.088	1.907E-1	513	0.017	0.018	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
15	PDB:3p8bB	0.091	0.304	1.907E-1	147	0.013	0.048	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
16	PDB:4v8mBU	0.086	0.254	2.144E-1	158	0.034	0.114	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:7f5sLT	0.088	0.258	2.558E-1	159	0.028	0.094	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
18	PDB:4zn3A	0.095	0.320	3.431E-1	147	0.011	0.041	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
19	PDB:5aj0AM	0.089	0.300	3.859E-1	139	0.011	0.043	5aj0AM.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:7okyZ	0.093	0.130	3.859E-1	374	0.019	0.027	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75475	0.0	1075	530	1.000	1.000	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
2	Q5XXA9	0.0	674	579	0.743	0.680	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
3	Q812D1	0.0	910	528	0.915	0.919	PSIP1_RAT PC4 and SFRS1-interacting protein OS=Rattus norvegicus OX=10116 GN=Psip1 PE=1 SV=1
4	Q99JF8	0.0	919	528	0.923	0.926	PSIP1_MOUSE PC4 and SFRS1-interacting protein OS=Mus musculus OX=10090 GN=Psip1 PE=1 SV=1
5	Q9Y3E1	1.08e-55	187	203	0.155	0.404	HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
6	Q9JMG7	6.23e-55	185	202	0.153	0.401	HDGR3_MOUSE Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2
7	Q5FVD1	1.07e-51	177	201	0.147	0.388	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
8	Q925G1	1.55e-50	186	669	0.155	0.123	HDGR2_RAT Hepatoma-derived growth factor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Hdgfl2 PE=1 SV=2
9	Q7Z4V5	2.27e-50	185	671	0.147	0.116	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
10	Q3UMU9	2.38e-50	185	669	0.153	0.121	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
11	P51859	6.77e-49	171	237	0.136	0.304	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
12	Q8VHK7	2.23e-48	169	237	0.134	0.300	HDGF_RAT Hepatoma-derived growth factor OS=Rattus norvegicus OX=10116 GN=Hdgf PE=1 SV=2
13	A0A384NPW1	7.19e-48	168	240	0.134	0.296	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
14	P51858	7.19e-48	168	240	0.134	0.296	HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1
15	H3BPM9	1.56e-10	61.6	141	0.057	0.213	H3BPM9_HUMAN HDGF like 3 (Fragment) OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
16	F4IN78	3.16e-09	62.4	1366	0.094	0.037	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
17	F4IZM8	6.23e-08	58.2	1347	0.047	0.019	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
18	Q9XER9	1.36e-07	57.0	1392	0.053	0.020	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
19	Q9LEY4	5.26e-07	55.1	1445	0.051	0.019	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
20	Q8T079	1.63e-05	50.1	602	0.055	0.048	GLYR1_DROME Cytokine-like nuclear factor N-PAC OS=Drosophila melanogaster OX=7227 GN=Ndf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11467 LEDGF	4.2e-24	95.9	Lens epithelium-derived growth factor (LEDGF)
2	PF00855 PWWP	9.8e-09	46.9	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337088	0.996	Menin
2	9606.ENSP00000383986	0.989	Cell division cycle-associated 7-like protein
3	9606.ENSP00000382628	0.983	DNA endonuclease RBBP8
4	9606.ENSP00000258962	0.976	Serine/arginine-rich splicing factor 1
5	9606.ENSP00000436786	0.969	Histone-lysine N-methyltransferase 2A
6	9606.ENSP00000271715	0.955	Pogo transposable element with ZNF domain
7	9606.ENSP00000319104	0.942	Transcription elongation factor SPT6
8	9606.ENSP00000398837	0.940	Histone-lysine N-methyltransferase 2B
9	9606.ENSP00000479618	0.912	Myc proto-oncogene protein
10	9606.ENSP00000244537	0.889	Histone cluster 1 H4 family member f
11	9606.ENSP00000347168	0.854	Histone cluster 1 H4 family member j
12	9606.ENSP00000366956	0.854	Histone cluster 1 H4 family member h
13	9606.ENSP00000366974	0.854	Histone cluster 1 H4 family member b
14	9606.ENSP00000367034	0.854	Histone cluster 1 H4 family member c
15	9606.ENSP00000443017	0.854	Histone cluster 4, H4
16	9606.ENSP00000462355	0.854	Histone cluster 2 H4 family member b
17	9606.ENSP00000462667	0.854	Histone cluster 2 H4 family member a
18	9606.ENSP00000479106	0.854	Histone cluster 1 H4 family member a
19	9606.ENSP00000479461	0.854	Histone cluster 1 H4 family member d
20	9606.ENSP00000479794	0.854	Histone cluster 1 H4 family member k

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.998	transcription factor binding
GO:0003723	0.998	RNA binding
GO:0003682	0.996	chromatin binding
GO:0003713	0.995	transcription coactivator activity
GO:0140297	0.994	DNA-binding transcription factor binding
GO:0003677	0.854	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0048518	0.942	positive regulation of biological process
GO:0006355	0.938	regulation of DNA-templated transcription
GO:0048522	0.926	positive regulation of cellular process
GO:0044238	0.922	primary metabolic process
GO:0009893	0.906	positive regulation of metabolic process
GO:0016043	0.905	cellular component organization
GO:0045935	0.902	positive regulation of nucleobase-containing compound metabolic process
GO:0006807	0.888	nitrogen compound metabolic process
GO:0071704	0.885	organic substance metabolic process
GO:0010604	0.878	positive regulation of macromolecule metabolic process
GO:0044237	0.839	cellular metabolic process
GO:0090304	0.815	nucleic acid metabolic process
GO:0050896	0.810	response to stimulus
GO:0051254	0.751	positive regulation of RNA metabolic process
GO:0009891	0.736	positive regulation of biosynthetic process
GO:0031328	0.729	positive regulation of cellular biosynthetic process
GO:0010557	0.727	positive regulation of macromolecule biosynthetic process
GO:0006357	0.721	regulation of transcription by RNA polymerase II
GO:0043933	0.718	protein-containing complex organization
GO:0000398	0.701	mRNA splicing, via spliceosome
GO:0071826	0.684	ribonucleoprotein complex subunit organization
GO:0022618	0.658	ribonucleoprotein complex assembly
GO:0045893	0.632	positive regulation of DNA-templated transcription
GO:0000245	0.604	spliceosomal complex assembly
GO:0006376	0.535	mRNA splice site selection
GO:0045292	0.443	mRNA cis splicing, via spliceosome
GO:0006950	0.407	response to stress
GO:0045944	0.363	positive regulation of transcription by RNA polymerase II
GO:0009628	0.353	response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005694	0.996	chromosome
GO:0000785	0.991	chromatin
GO:0005737	0.955	cytoplasm
GO:0005829	0.940	cytosol
GO:0032991	0.919	protein-containing complex
GO:0000792	0.903	heterochromatin
GO:0034399	0.398	nuclear periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]