StarFunc result for job id O75477

User Input

>input (348 residues)
MNMTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKET
EKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNSKIYFG
SNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75477	1.000	1.000	5.783E-58	348	1.000	1.000	O75477.pdb.gz	ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2
2	AFDB:Q8BFZ9	0.800	0.818	1.408E-45	340	0.721	0.738	Q8BFZ9.pdb.gz	ERLN2_MOUSE Erlin-2 OS=Mus musculus OX=10090 GN=Erlin2 PE=1 SV=1
3	AFDB:A3QMC6	0.748	0.826	2.869E-39	312	0.566	0.631	A3QMC6.pdb.gz	ERLN_CAEEL Erlin OS=Caenorhabditis elegans OX=6239 GN=erl-1 PE=1 SV=1
4	AFDB:Q9ZQ87	0.745	0.730	1.751E-35	356	0.466	0.455	Q9ZQ87.pdb.gz	Q9ZQ87_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=1 SV=2
5	AFDB:Q0PBN7	0.548	0.529	2.380E-16	362	0.181	0.174	Q0PBN7.pdb.gz	Q0PBN7_CAMJE Transmembrane protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj0268c PE=4 SV=1
6	AFDB:P0ABC7	0.479	0.408	5.196E-15	419	0.170	0.141	P0ABC7.pdb.gz	HFLK_ECOLI Modulator of FtsH protease HflK OS=Escherichia coli (strain K12) OX=83333 GN=hflK PE=1 SV=1
7	AFDB:O94550	0.443	0.522	7.416E-15	288	0.149	0.181	O94550.pdb.gz	PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb2 PE=1 SV=2
8	AFDB:Q57UX1	0.398	0.487	8.860E-15	277	0.152	0.191	Q57UX1.pdb.gz	Q57UX1_TRYB2 Prohibitin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.510 PE=3 SV=1
9	AFDB:P40961	0.451	0.530	1.123E-14	287	0.161	0.195	P40961.pdb.gz	PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHB1 PE=1 SV=2
10	AFDB:Q9P7H3	0.461	0.551	1.265E-14	282	0.155	0.191	Q9P7H3.pdb.gz	PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb1 PE=3 SV=1
11	PDB:7vhpG	0.408	0.464	2.009E-14	299	0.181	0.211	7vhpG.pdb.gz
12	PDB:7wi3B	0.386	0.465	6.139E-9	275	0.155	0.196	7wi3B.pdb.gz
13	PDB:4v60A	0.327	0.157	2.308E-6	812	0.175	0.075	4v60A.pdb.gz
14	PDB:4v8mA0	0.173	0.240	9.868E-3	218	0.069	0.110	4v8mA0.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:7d4iSC	0.176	0.236	2.402E-2	242	0.052	0.074	7d4iSC.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:7pzyC	0.192	0.273	2.704E-2	214	0.066	0.107	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:7bspA	0.097	0.042	8.852E-2	1028	0.063	0.021	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:2pl5A	0.068	0.066	8.940E-1	362	0.006	0.006	2pl5A.pdb.gz
19	PDB:1ds7A	0.108	0.161	1.068	217	0.060	0.097	1ds7A.pdb.gz	Crystal structure of FMN-dependent nitroreductase from Escherichia coli B: a prodrug-activating enzyme.
20	PDB:6cd2C	0.082	0.043	1.068	727	0.040	0.019	6cd2C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384ME54	0.0	514	339	0.707	0.726	A0A384ME54_HUMAN Erlin OS=Homo sapiens OX=9606 PE=2 SV=1
2	E5RHW4	0.0	514	338	0.707	0.728	E5RHW4_HUMAN Erlin (Fragment) OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1
3	O75477	0.0	717	348	1.000	1.000	ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2
4	O94905	0.0	514	339	0.707	0.726	ERLN2_HUMAN Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1
5	Q8BFZ9	0.0	514	340	0.710	0.726	ERLN2_MOUSE Erlin-2 OS=Mus musculus OX=10090 GN=Erlin2 PE=1 SV=1
6	A3QMC6	2.86e-141	404	312	0.566	0.631	ERLN_CAEEL Erlin OS=Caenorhabditis elegans OX=6239 GN=erl-1 PE=1 SV=1
7	Q9ZQ87	1.54e-120	353	356	0.477	0.466	Q9ZQ87_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=1 SV=2
8	Q0PBN7	0.001	42.7	362	0.190	0.182	Q0PBN7_CAMJE Transmembrane protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj0268c PE=4 SV=1
9	P9WPR9	0.035	38.1	381	0.198	0.181	Y1488_MYCTU Uncharacterized protein Rv1488 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1488 PE=1 SV=1
10	Q9LRI8	0.53	34.7	562	0.075	0.046	PPOC_SPIOL Protoporphyrinogen oxidase 1, chloroplastic OS=Spinacia oleracea OX=3562 GN=POX1 PE=1 SV=1
11	A4FVJ0	1.00	33.5	391	0.152	0.136	A4FVJ0_DANRE NPHS2 stomatin family member, podocin OS=Danio rerio OX=7955 GN=nphs2l PE=2 SV=1
12	C1P640	1.3	33.5	3683	0.106	0.010	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
13	C1P641	1.3	33.5	3663	0.106	0.010	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
14	G5EEV6	1.3	33.5	3704	0.106	0.010	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
15	P0ABC3	1.3	33.1	334	0.046	0.048	HFLC_ECOLI Modulator of FtsH protease HflC OS=Escherichia coli (strain K12) OX=83333 GN=hflC PE=1 SV=1
16	Q21313	1.3	33.5	3672	0.106	0.010	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
17	Q91Z69	1.5	33.5	1062	0.080	0.026	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
18	P0A7N9	1.6	30.0	55	0.046	0.291	RL33_ECOLI Large ribosomal subunit protein bL33 OS=Escherichia coli (strain K12) OX=83333 GN=rpmG PE=1 SV=2
19	Q7Z6B7	1.9	33.1	1085	0.060	0.019	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
20	Q91X05	3.6	32.0	385	0.152	0.138	PODO_MOUSE Podocin OS=Mus musculus OX=10090 GN=Nphs2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	2.5e-18	78.2	SPFH domain / Band 7 family
2	PF06628 Catalase-rel	71	15.0	Catalase-related immune-responsive
3	PF14251 DUF4346	2e+02	13.4	Domain of unknown function (DUF4346)
4	PF15937 PrlF_antitoxin	2.8e+02	13.3	prlF antitoxin for toxin YhaV_toxin
5	PF00471 Ribosomal_L33	2.6e+02	13.5	Ribosomal protein L33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276461	0.975	Erlin-2
2	9606.ENSP00000479488	0.945	Prohibitin
3	9606.ENSP00000445725	0.871	E3 ubiquitin-protein ligase RNF170
4	9606.ENSP00000290649	0.849	E3 ubiquitin-protein ligase AMFR
5	9606.ENSP00000328551	0.841	Ras-related protein Rab-28
6	9606.ENSP00000351777	0.837	Transitional endoplasmic reticulum ATPase
7	9606.ENSP00000478070	0.825	CWC25 spliceosome associated protein homolog
8	9606.ENSP00000430236	0.816	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
9	9606.ENSP00000306253	0.797	Inositol 1,4,5-trisphosphate receptor type 1
10	9606.ENSP00000318147	0.740	ER degradation-enhancing alpha-mannosidase-like protein 3
11	9606.ENSP00000318165	0.726	Protein OS-9
12	9606.ENSP00000320821	0.724	Kinesin-like protein KIF1C
13	9606.ENSP00000259512	0.719	Derlin-1
14	9606.ENSP00000339479	0.715	Cytosolic purine 5'-nucleotidase
15	9606.ENSP00000244051	0.710	Adenylyltransferase and sulfurtransferase MOCS3
16	9606.ENSP00000304437	0.708	Protein very KIND
17	9606.ENSP00000355251	0.706	Zinc finger protein 511
18	9606.ENSP00000364235	0.698	E3 ubiquitin-protein ligase RNF5
19	9606.ENSP00000337053	0.694	Protein sel-1 homolog 1
20	9606.ENSP00000185150	0.683	Endoplasmic reticulum lectin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032934	1.000	sterol binding
GO:0043178	0.999	alcohol binding
GO:0015485	0.992	cholesterol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034976	0.996	response to endoplasmic reticulum stress
GO:0019216	0.995	regulation of lipid metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0019218	0.992	regulation of steroid metabolic process
GO:0051055	0.992	negative regulation of lipid biosynthetic process
GO:0062012	0.991	regulation of small molecule metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044260	0.989	cellular macromolecule metabolic process
GO:0009056	0.987	catabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0030433	0.984	ubiquitin-dependent ERAD pathway
GO:1902930	0.957	regulation of alcohol biosynthetic process
GO:0010565	0.956	regulation of cellular ketone metabolic process
GO:0019217	0.953	regulation of fatty acid metabolic process
GO:0050810	0.948	regulation of steroid biosynthetic process
GO:0062014	0.944	negative regulation of small molecule metabolic process
GO:0023052	0.941	signaling
GO:0007154	0.941	cell communication
GO:0006984	0.934	ER-nucleus signaling pathway
GO:0048523	0.920	negative regulation of cellular process
GO:0031327	0.897	negative regulation of cellular biosynthetic process
GO:0045922	0.886	negative regulation of fatty acid metabolic process
GO:0090181	0.885	regulation of cholesterol metabolic process
GO:0042304	0.884	regulation of fatty acid biosynthetic process
GO:0106118	0.356	regulation of sterol biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.999	organelle membrane
GO:0005789	0.988	endoplasmic reticulum membrane
GO:0032991	0.983	protein-containing complex
GO:0071944	0.852	cell periphery
GO:0005886	0.840	plasma membrane
GO:0005829	0.835	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]