StarFunc result for job id O75478

User Input

>input (443 residues)
MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHT
YEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFIN
NPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFD
NYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLME
RRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSA
RTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSIPMASNSGRR
SAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALI
KIDVNKTRKIYDFLIREGYITKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0Y4	0.457	0.457	1.940E-65	443	0.998	0.998	A0A024R0Y4.pdb.gz	A0A024R0Y4_HUMAN Transcriptional adapter OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=1
2	AFDB:E1JIP2	0.360	0.308	3.499E-28	527	0.350	0.294	E1JIP2.pdb.gz	E1JIP2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=4 SV=1
3	AFDB:Q7KSD8	0.349	0.281	1.891E-27	562	0.348	0.274	Q7KSD8.pdb.gz	TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=1 SV=1
4	AFDB:Q59WH0	0.342	0.341	1.671E-25	445	0.293	0.292	Q59WH0.pdb.gz	ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADA2 PE=3 SV=2
5	AFDB:Q02336	0.326	0.332	1.700E-24	434	0.284	0.290	Q02336.pdb.gz	ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADA2 PE=1 SV=1
6	AFDB:C8V3C2	0.329	0.284	3.037E-24	517	0.330	0.282	C8V3C2.pdb.gz	C8V3C2_EMENI Transcriptional adapter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10763 PE=4 SV=1
7	AFDB:Q6FMQ2	0.364	0.363	3.037E-24	445	0.293	0.292	Q6FMQ2.pdb.gz	Q6FMQ2_CANGA Transcriptional adapter 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ADA2 PE=4 SV=1
8	AFDB:Q9ATB4	0.327	0.299	7.443E-24	487	0.302	0.275	Q9ATB4.pdb.gz	TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana OX=3702 GN=ADA2B PE=1 SV=1
9	AFDB:F4JFM6	0.318	0.257	1.641E-23	555	0.302	0.241	F4JFM6.pdb.gz	F4JFM6_ARATH Transcriptional adapter OS=Arabidopsis thaliana OX=3702 GN=ADA2A PE=1 SV=1
10	AFDB:Q54VX6	0.392	0.205	4.967E-23	914	0.309	0.150	Q54VX6.pdb.gz	Q54VX6_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280079 PE=4 SV=1
11	PDB:6tdaL	0.132	0.099	2.862E-4	596	0.140	0.104	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
12	PDB:6k15H	0.118	0.129	8.812E-3	393	0.097	0.109	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	PDB:6lthO	0.105	0.142	1.167E-1	325	0.117	0.160	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
14	PDB:5z56L	0.089	0.114	1.977E-1	342	0.108	0.140	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:2cjjA	0.092	0.600	2.713E-1	63	0.032	0.222	2cjjA.pdb.gz
16	PDB:7abgA4	0.095	0.102	7.788E-1	405	0.133	0.146	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:5yzgL	0.103	0.108	8.210E-1	419	0.111	0.117	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7vdvW	0.104	0.181	9.123E-1	248	0.095	0.169	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:6jbjA	0.066	0.054	9.617E-1	565	0.138	0.108	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
20	PDB:7c4jB	0.108	0.120	9.617E-1	395	0.102	0.114	7c4jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R0Y4	0.0	926	443	0.998	0.998	A0A024R0Y4_HUMAN Transcriptional adapter OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=1
2	O75478	0.0	928	443	1.000	1.000	TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=3
3	Q8CHV6	0.0	904	443	0.971	0.971	TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus OX=10090 GN=Tada2a PE=1 SV=1
4	E1JIP2	5.26e-68	227	527	0.363	0.306	E1JIP2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=4 SV=1
5	Q7KSD8	3.78e-64	218	562	0.366	0.288	TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=1 SV=1
6	Q02336	2.80e-57	196	434	0.293	0.300	ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADA2 PE=1 SV=1
7	Q6FMQ2	3.57e-56	194	445	0.305	0.303	Q6FMQ2_CANGA Transcriptional adapter 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ADA2 PE=4 SV=1
8	Q59WH0	2.64e-55	191	445	0.302	0.301	ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADA2 PE=3 SV=2
9	C8V3C2	1.35e-52	186	517	0.339	0.290	C8V3C2_EMENI Transcriptional adapter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10763 PE=4 SV=1
10	Q9P7J7	9.57e-51	179	437	0.291	0.295	ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada2 PE=1 SV=1
11	Q9ATB4	3.18e-50	179	487	0.302	0.275	TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana OX=3702 GN=ADA2B PE=1 SV=1
12	Q75LL6	2.78e-46	170	567	0.307	0.240	TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica OX=39947 GN=ADA2 PE=1 SV=2
13	Q54VX6	6.09e-41	157	914	0.307	0.149	Q54VX6_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280079 PE=4 SV=1
14	D3Z4Z0	9.55e-41	152	420	0.273	0.288	D3Z4Z0_MOUSE Transcriptional adapter OS=Mus musculus OX=10090 GN=Tada2b PE=1 SV=1
15	Q86TJ2	2.40e-40	151	420	0.271	0.286	TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens OX=9606 GN=TADA2B PE=1 SV=2
16	Q8IJP9	2.00e-38	150	2578	0.278	0.048	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
17	A0A0B4KFU2	1.20e-33	132	418	0.219	0.232	A0A0B4KFU2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=4 SV=1
18	Q8I8V0	4.99e-33	133	555	0.217	0.173	TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=1 SV=1
19	D3YW26	1.96e-23	102	345	0.208	0.267	D3YW26_MOUSE Transcriptional adaptor 2B OS=Mus musculus OX=10090 GN=Tada2b PE=1 SV=1
20	Q9SFD5	2.94e-21	98.6	548	0.181	0.146	TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana OX=3702 GN=ADA2A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	2.6e-07	42.0	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	0.015	26.8	Myb-like DNA-binding domain
3	PF08784 RPA_C	6.6e+02	12.4	Replication protein A C terminal
4	PF04433 SWIRM	0.00013	33.5	SWIRM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375169.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010367709.1	0.998	Transcriptional adapter 3
2	61622.XP_010384973.1	0.994	Belongs to the acetyltransferase family. GCN5 subfamily.
3	61622.XP_010364517.1	0.993	YEATS domain-containing protein 2 isoform X1
4	61622.XP_010365909.1	0.992	Belongs to the acetyltransferase family. GCN5 subfamily.
5	61622.XP_010371076.1	0.991	WD repeat domain 5
6	61622.XP_010378636.1	0.988	TATA-box binding protein associated factor 12
7	61622.XP_010352261.1	0.987	Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Within the complex, it is required to recruit USP22 and ENY2 into the SAGA complex. [...]
8	61622.XP_010370842.1	0.987	SPT3 homolog, SAGA and STAGA complex component
9	61622.XP_010371678.1	0.985	Transcriptional adapter 1
10	61622.XP_010379789.1	0.984	Lysine acetyltransferase 14
11	61622.XP_010375985.1	0.982	TATA-box binding protein associated factor 6
12	61622.XP_010383418.1	0.982	Down-regulator of transcription 1
13	61622.XP_010386996.1	0.981	SAGA-associated factor 29 homolog
14	61622.XP_010387001.1	0.981	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
15	61622.XP_010387811.1	0.979	TATA-box binding protein associated factor 9b
16	61622.XP_010363628.1	0.978	MAP3K12-binding inhibitory protein 1 isoform X1
17	61622.XP_010369496.1	0.978	STAGA complex 65 subunit gamma isoform X1
18	61622.XP_010383167.1	0.977	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
19	61622.XP_010354502.1	0.976	TATA-box binding protein associated factor 5
20	61622.XP_010372336.1	0.976	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.497	nucleic acid binding
GO:0140110	0.481	transcription regulator activity
GO:0003677	0.469	DNA binding
GO:0003824	0.340	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051302	0.996	regulation of cell division
GO:0031063	0.996	regulation of histone deacetylation
GO:0051726	0.995	regulation of cell cycle
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0043543	0.966	protein acylation
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0006473	0.959	protein acetylation
GO:0006475	0.944	internal protein amino acid acetylation
GO:0018205	0.942	peptidyl-lysine modification
GO:0009987	0.940	cellular process
GO:0016570	0.937	histone modification
GO:0016573	0.929	histone acetylation
GO:0031326	0.913	regulation of cellular biosynthetic process
GO:0019219	0.902	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.890	regulation of RNA metabolic process
GO:0010468	0.888	regulation of gene expression
GO:0006355	0.879	regulation of DNA-templated transcription
GO:0006357	0.846	regulation of transcription by RNA polymerase II
GO:0043966	0.610	histone H3 acetylation
GO:0048518	0.403	positive regulation of biological process
GO:0009893	0.341	positive regulation of metabolic process
GO:0048522	0.339	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070461	1.000	SAGA-type complex
GO:0043233	0.975	organelle lumen
GO:0005654	0.965	nucleoplasm
GO:0140672	0.945	ATAC complex
GO:0000124	0.508	SAGA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]