StarFunc result for job id O75486

User Input

>input (317 residues)
MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLI
NLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLL
EDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSA
QYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVR
QDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
SPFTNAYRRNGMAFLAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD67	0.874	0.874	7.479E-38	317	1.000	1.000	A0A024RD67.pdb.gz
2	AFDB:B0QZW4	0.816	0.643	6.777E-32	406	0.868	0.677	B0QZW4.pdb.gz	B0QZW4_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
3	AFDB:B0QZW5	0.688	0.575	5.816E-27	382	0.773	0.641	B0QZW5.pdb.gz	B0QZW5_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
4	PDB:7ktrI	0.611	0.787	7.510E-22	243	0.729	0.951	7ktrI.pdb.gz	Structure of the human SAGA coactivator complex.
5	AFDB:Q8I8U9	0.634	0.489	2.540E-11	426	0.278	0.207	Q8I8U9.pdb.gz	Q8I8U9_DROME Suppressor of Ty 3 OS=Drosophila melanogaster OX=7227 GN=Spt3 PE=2 SV=1
6	AFDB:O14311	0.644	0.663	3.533E-11	307	0.256	0.264	O14311.pdb.gz	SPT3_SCHPO SAGA complex subunit spt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt3 PE=1 SV=2
7	AFDB:A0A1D8PU74	0.619	0.600	1.261E-10	328	0.252	0.244	A0A1D8PU74.pdb.gz	A0A1D8PU74_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT3 PE=4 SV=1
8	AFDB:Q5BFG1	0.564	0.542	4.296E-10	331	0.249	0.239	Q5BFG1.pdb.gz	Q5BFG1_EMENI SAGA-like transcriptional regulatory complex subunit Spt3, putative (AFU_orthologue AFUA_1G14030) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00719 PE=4 SV=1
9	AFDB:P06844	0.593	0.561	5.701E-10	337	0.259	0.243	P06844.pdb.gz	SPT3_YEAST Protein SPT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT3 PE=1 SV=1
10	PDB:6t9iC	0.471	0.680	1.617E-6	214	0.224	0.332	6t9iC.pdb.gz
11	AFDB:Q5VWT9	0.173	0.466	5.596E-6	108	0.271	0.796	Q5VWT9.pdb.gz	Q5VWT9_HUMAN SPT3 homolog, SAGA and STAGA complex component OS=Homo sapiens OX=9606 GN=SUPT3H PE=4 SV=1
12	AFDB:Q9XVX8	0.563	0.517	5.636E-5	348	0.183	0.167	Q9XVX8.pdb.gz	Q9XVX8_CAEEL Uncharacterized protein OS=Caenorhabditis elegans OX=6239 GN=tag-342 PE=1 SV=2
13	PDB:6a7uA	0.324	0.553	2.814E-1	170	0.095	0.176	6a7uA.pdb.gz
14	PDB:3ipiA	0.208	0.236	1.769	268	0.098	0.116	3ipiA.pdb.gz
15	PDB:2rvqC	0.196	0.428	1.855	133	0.044	0.105	2rvqC.pdb.gz
16	PDB:2azjA	0.159	0.171	2.038	276	0.079	0.091	2azjA.pdb.gz
17	PDB:4okmA	0.143	0.133	2.136	346	0.088	0.081	4okmA.pdb.gz	Induced-fit mechanism in class i terpene cyclases.
18	PDB:3aqbD	0.179	0.175	2.461	325	0.104	0.102	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
19	PDB:7f02B	0.141	0.190	2.835	220	0.073	0.105	7f02B.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
20	PDB:1wmwA	0.120	0.119	2.971	328	0.098	0.095	1wmwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PRV1	0.0	591	284	0.893	0.996	A0A6I8PRV1_HUMAN SPT3 homolog, SAGA and STAGA complex component (Fragment) OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=1
2	O75486	0.0	660	317	1.000	1.000	SUPT3_HUMAN Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3
3	Q8BVY4	1.12e-178	500	374	0.773	0.655	Q8BVY4_MOUSE SPT3, SAGA and STAGA complex component OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
4	Q8BU36	8.12e-178	498	374	0.770	0.652	Q8BU36_MOUSE Transcription initiation protein SPT3 homolog OS=Mus musculus OX=10090 GN=Supt3 PE=2 SV=1
5	Q8BWQ2	8.87e-178	498	374	0.770	0.652	Q8BWQ2_MOUSE Transcription initiation protein SPT3 homolog OS=Mus musculus OX=10090 GN=Supt3 PE=2 SV=1
6	B0QZW4	4.83e-177	497	406	0.754	0.589	B0QZW4_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
7	B0QZW5	1.15e-176	495	382	0.773	0.641	B0QZW5_MOUSE SPT3, SAGA and STAGA complex component (Fragment) OS=Mus musculus OX=10090 GN=Supt3 PE=1 SV=1
8	B4E1H0	5.14e-123	351	165	0.521	1.000	B4E1H0_HUMAN cDNA FLJ50351, highly similar to Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 PE=2 SV=1
9	Q5VWT9	6.06e-59	186	108	0.274	0.806	Q5VWT9_HUMAN SPT3 homolog, SAGA and STAGA complex component OS=Homo sapiens OX=9606 GN=SUPT3H PE=4 SV=1
10	O14311	1.11e-33	127	307	0.281	0.290	SPT3_SCHPO SAGA complex subunit spt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt3 PE=1 SV=2
11	P06844	2.53e-26	108	337	0.268	0.252	SPT3_YEAST Protein SPT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT3 PE=1 SV=1
12	A0A1D8PU74	2.82e-24	102	328	0.268	0.259	A0A1D8PU74_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT3 PE=4 SV=1
13	Q9VGE2	1.72e-21	95.9	384	0.281	0.232	Q9VGE2_DROME FI01013p OS=Drosophila melanogaster OX=7227 GN=Spt3 PE=2 SV=1
14	Q5BFG1	2.54e-21	94.7	331	0.268	0.257	Q5BFG1_EMENI SAGA-like transcriptional regulatory complex subunit Spt3, putative (AFU_orthologue AFUA_1G14030) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00719 PE=4 SV=1
15	Q8I8U9	2.57e-21	95.9	426	0.281	0.209	Q8I8U9_DROME Suppressor of Ty 3 OS=Drosophila melanogaster OX=7227 GN=Spt3 PE=2 SV=1
16	Q6NQH4	5.98e-11	61.2	126	0.107	0.270	TAF13_ARATH Transcription initiation factor TFIID subunit 13 OS=Arabidopsis thaliana OX=3702 GN=TAF13 PE=1 SV=1
17	Q9VIP1	2.22e-08	54.3	136	0.104	0.243	Q9VIP1_DROME GEO07843p1 OS=Drosophila melanogaster OX=7227 GN=Taf13 PE=1 SV=1
18	P61216	2.10e-06	48.5	124	0.091	0.234	TAF13_MOUSE Transcription initiation factor TFIID subunit 13 OS=Mus musculus OX=10090 GN=Taf13 PE=1 SV=1
19	Q15543	2.10e-06	48.5	124	0.091	0.234	TAF13_HUMAN Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1
20	O60076	0.002	39.3	111	0.076	0.216	TAF13_SCHPO Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf13 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	3e+02	13.1	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF13331 DUF4093	33	16.4	Domain of unknown function (DUF4093)
3	PF18268 Hit1_C	4.7e+02	12.4	Hit1 C-terminal
4	PF02269 TFIID-18kDa	2e-33	125.6	Transcription initiation factor IID, 18kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000018640

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000019457	0.988	Transformation/transcription domain-associated protein
2	9601.ENSPPYP00000001889	0.987	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
3	9601.ENSPPYP00000004055	0.987	Transcription initiation factor TFIID subunit 10
4	9601.ENSPPYP00000015742	0.986	K(lysine) acetyltransferase 2B
5	9601.ENSPPYP00000015293	0.983	Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53- dependent transcriptional activation (By similarity). Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity)
6	9601.ENSPPYP00000022945	0.983	Transcription initiation factor TFIID subunit 9B
7	9601.ENSPPYP00000008178	0.982	SAGA complex associated factor 29
8	9601.ENSPPYP00000019499	0.982	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
9	9601.ENSPPYP00000016284	0.981	Coactivates PAX5-dependent transcription together with either SMARCA4 or GCN5L2
10	9601.ENSPPYP00000014002	0.936	SPT7 like, STAGA complex gamma subunit
11	9601.ENSPPYP00000012895	0.929	CECR2, histone acetyl-lysine reader
12	9601.ENSPPYP00000009076	0.927	Ubiquitinyl hydrolase 1
13	9601.ENSPPYP00000015372	0.927	Ataxin 7
14	9601.ENSPPYP00000000126	0.923	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
15	9601.ENSPPYP00000003048	0.923	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
16	9601.ENSPPYP00000022778	0.915	Ubiquitinyl hydrolase 1
17	9601.ENSPPYP00000006636	0.914	TATA box binding protein like 2
18	9601.ENSPPYP00000019257	0.914	TATA box binding protein
19	9601.ENSPPYP00000009236	0.913	Transcriptional adaptor 2A
20	9601.ENSPPYP00000020483	0.908	Ataxin 7-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0005488	0.978	binding
GO:0005515	0.966	protein binding
GO:0097159	0.485	organic cyclic compound binding
GO:1901363	0.482	heterocyclic compound binding
GO:0003676	0.447	nucleic acid binding
GO:0003824	0.330	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0043966	0.987	histone H3 acetylation
GO:0006366	0.983	transcription by RNA polymerase II
GO:0070646	0.940	protein modification by small protein removal
GO:0050789	0.937	regulation of biological process
GO:1903506	0.932	regulation of nucleic acid-templated transcription
GO:0016579	0.927	protein deubiquitination
GO:0006357	0.920	regulation of transcription by RNA polymerase II
GO:0016578	0.899	histone deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031974	0.995	membrane-enclosed lumen
GO:0005634	0.995	nucleus
GO:0005654	0.993	nucleoplasm
GO:0032991	0.839	protein-containing complex
GO:0043232	0.725	intracellular non-membrane-bounded organelle
GO:0000785	0.678	chromatin
GO:0000124	0.646	SAGA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]