StarFunc result for job id O75489

User Input

>input (264 residues)
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA
FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN
HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPVYRQPPESLKLEAGDKKPDAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75489	1.000	1.000	2.295E-51	264	1.000	1.000	O75489.pdb.gz	NDUS3_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1
2	AFDB:P23709	0.881	0.875	3.853E-48	266	0.898	0.891	P23709.pdb.gz	NDUS3_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS3 PE=1 SV=1
3	AFDB:D3ZG43	0.844	0.844	1.783E-45	264	0.848	0.848	D3ZG43.pdb.gz	D3ZG43_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs3 PE=3 SV=1
4	PDB:7qsoC	0.786	0.986	2.295E-39	210	0.765	0.962	7qsoC.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	AFDB:Q9VZU4	0.772	0.769	3.265E-37	265	0.625	0.623	Q9VZU4.pdb.gz	NDUS3_DROME NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-30 PE=1 SV=1
6	AFDB:Q86NC2	0.767	0.756	2.625E-34	268	0.511	0.504	Q86NC2.pdb.gz	Q86NC2_CAEEL NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-2 PE=1 SV=1
7	AFDB:A0A1D8PJ73	0.741	0.703	9.207E-31	279	0.455	0.430	A0A1D8PJ73.pdb.gz	A0A1D8PJ73_CANAL Ali1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALI1 PE=3 SV=1
8	AFDB:Q2F951	0.673	0.929	1.099E-24	190	0.383	0.532	Q2F951.pdb.gz	Q2F951_ORYSI NADH dehydrogenase subunit 9 OS=Oryza sativa subsp. indica OX=39946 GN=nad9 PE=3 SV=1
9	AFDB:O25852	0.520	0.516	1.478E-14	266	0.220	0.218	O25852.pdb.gz	O25852_HELPY NADH-quinone oxidoreductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_1262 PE=1 SV=1
10	AFDB:P9WJH3	0.535	0.596	1.478E-14	236	0.189	0.212	P9WJH3.pdb.gz	NUOC_MYCTU NADH-quinone oxidoreductase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoC PE=1 SV=1
11	AFDB:Q608X9	0.496	0.234	1.085E-12	587	0.208	0.094	Q608X9.pdb.gz	NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nuoC PE=3 SV=1
12	PDB:7awtD	0.461	0.215	4.370E-11	589	0.178	0.080	7awtD.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
13	PDB:7wfgJ	0.469	0.767	2.355E-7	155	0.148	0.252	7wfgJ.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
14	PDB:6cfwK	0.438	0.671	6.685E-7	166	0.095	0.151	6cfwK.pdb.gz	Structure of an Ancient Respiratory System.
15	PDB:4ud5B	0.208	0.170	2.730E-2	342	0.042	0.032	4ud5B.pdb.gz
16	PDB:7co6A	0.197	0.167	1.266E-1	332	0.083	0.066	7co6A.pdb.gz	Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
17	PDB:3hj1B	0.208	0.154	1.347E-1	387	0.057	0.039	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
18	PDB:4rwnA	0.193	0.159	1.522E-1	349	0.068	0.052	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
19	PDB:2r5vA	0.193	0.149	1.830E-1	346	0.015	0.012	2r5vA.pdb.gz	Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate.
20	PDB:5ymxA	0.162	0.199	1.830E-1	202	0.049	0.064	5ymxA.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75489	0.0	543	264	1.000	1.000	NDUS3_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1
2	P23709	1.88e-176	488	266	0.883	0.876	NDUS3_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS3 PE=1 SV=1
3	Q9DCT2	2.56e-173	480	263	0.871	0.875	NDUS3_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs3 PE=1 SV=2
4	D3ZG43	1.61e-169	470	264	0.852	0.852	D3ZG43_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs3 PE=3 SV=1
5	A0A8I6ADT5	7.15e-147	413	262	0.742	0.748	A0A8I6ADT5_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs3 PE=1 SV=1
6	Q9VZU4	6.19e-113	327	265	0.625	0.623	NDUS3_DROME NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-30 PE=1 SV=1
7	Q86NC2	1.12e-97	288	268	0.485	0.478	Q86NC2_CAEEL NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-2 PE=1 SV=1
8	A0A1D8PJ73	1.72e-75	233	279	0.436	0.412	A0A1D8PJ73_CANAL Ali1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALI1 PE=3 SV=1
9	Q7JAI4	1.19e-72	222	190	0.409	0.568	Q7JAI4_ORYSJ NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=nad9 PE=3 SV=2
10	Q35322	1.54e-72	222	190	0.409	0.568	NDUS3_ORYSJ NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=NAD9 PE=2 SV=2
11	Q2F951	1.86e-63	199	190	0.383	0.532	Q2F951_ORYSI NADH dehydrogenase subunit 9 OS=Oryza sativa subsp. indica OX=39946 GN=nad9 PE=3 SV=1
12	Q608X9	1.60e-22	98.6	587	0.189	0.085	NUOCD_METCA NADH-quinone oxidoreductase subunit C/D OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nuoC PE=3 SV=1
13	O25852	1.45e-17	82.0	266	0.170	0.169	O25852_HELPY NADH-quinone oxidoreductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_1262 PE=1 SV=1
14	P9WJH3	3.03e-16	77.8	236	0.235	0.263	NUOC_MYCTU NADH-quinone oxidoreductase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoC PE=1 SV=1
15	P33599	4.41e-15	76.6	596	0.152	0.067	NUOCD_ECOLI NADH-quinone oxidoreductase subunit C/D OS=Escherichia coli (strain K12) OX=83333 GN=nuoC PE=1 SV=3
16	P56754	7.50e-07	50.1	158	0.106	0.177	NDHJ_ARATH NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhJ PE=1 SV=1
17	P0C338	1.86e-06	48.9	159	0.098	0.164	NDHJ_ORYSA NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Oryza sativa OX=4530 GN=ndhJ PE=3 SV=1
18	P0C339	1.86e-06	48.9	159	0.098	0.164	NDHJ_ORYSI NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhJ PE=3 SV=1
19	P0C340	1.86e-06	48.9	159	0.098	0.164	NDHJ_ORYSJ NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhJ PE=3 SV=1
20	Q6ENH1	1.86e-06	48.9	159	0.098	0.164	NDHJ_ORYNI NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Oryza nivara OX=4536 GN=ndhJ PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00329 Complex1_30kDa	4.7e-40	148.4	Respiratory-chain NADH dehydrogenase, 30 Kd subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263774

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000260361	0.999	Complex I intermediate-associated protein 30, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276062	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
12	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
13	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
14	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
15	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
16	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
17	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
18	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
19	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
20	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.986	cellular metabolic process
GO:0007005	0.986	mitochondrion organization
GO:0065003	0.985	protein-containing complex assembly
GO:0032981	0.984	mitochondrial respiratory chain complex I assembly
GO:0006119	0.968	oxidative phosphorylation
GO:0006120	0.947	mitochondrial electron transport, NADH to ubiquinone
GO:0065007	0.566	biological regulation
GO:0050794	0.500	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.998	mitochondrial respiratory chain complex I
GO:0031974	0.856	membrane-enclosed lumen
GO:0043233	0.849	organelle lumen
GO:0070013	0.842	intracellular organelle lumen
GO:0005634	0.614	nucleus
GO:0005759	0.460	mitochondrial matrix
GO:0031981	0.344	nuclear lumen
GO:0043228	0.300	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]