StarFunc result for job id O75494

User Input

>input (262 residues)
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z504	0.382	0.382	3.861E-37	262	1.000	1.000	A0A0S2Z504.pdb.gz	A0A0S2Z504_HUMAN Serine/arginine-rich splicing factor 10 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF10 PE=2 SV=1
2	AFDB:Q8WXF0	0.394	0.396	7.889E-22	261	0.565	0.567	Q8WXF0.pdb.gz	SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1
3	AFDB:Q9SEU4	0.392	0.360	1.487E-15	287	0.378	0.345	Q9SEU4.pdb.gz	SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana OX=3702 GN=SCL33 PE=1 SV=1
4	AFDB:Q9LHP2	0.375	0.375	2.077E-15	262	0.328	0.328	Q9LHP2.pdb.gz	SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana OX=3702 GN=SCL30A PE=1 SV=1
5	AFDB:Q1PDV2	0.364	0.396	2.714E-15	236	0.267	0.297	Q1PDV2.pdb.gz	SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana OX=3702 GN=SCL28 PE=1 SV=1
6	AFDB:Q8I468	0.357	0.305	1.652E-14	308	0.321	0.273	Q8I468.pdb.gz	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
7	AFDB:Q8L3X8	0.351	0.351	3.017E-14	262	0.332	0.332	Q8L3X8.pdb.gz	SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana OX=3702 GN=SCL30 PE=1 SV=1
8	AFDB:Q09511	0.310	0.412	1.118E-12	196	0.305	0.408	Q09511.pdb.gz	RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans OX=6239 GN=rsp-4 PE=3 SV=1
9	AFDB:Q84TH4	0.333	0.236	2.182E-12	382	0.359	0.246	Q84TH4.pdb.gz	SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana OX=3702 GN=SR45A PE=1 SV=1
10	AFDB:Q8WUA2	0.309	0.166	2.182E-12	492	0.214	0.114	Q8WUA2.pdb.gz	PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1
11	PDB:6qx91K	0.303	0.391	1.272E-9	201	0.111	0.144	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:5yzg1	0.294	0.317	2.031E-9	243	0.103	0.111	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6ff7X	0.281	0.421	7.741E-9	171	0.103	0.158	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:7dvqY	0.316	0.579	8.849E-9	140	0.095	0.179	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3lqvB	0.279	0.611	9.462E-9	115	0.118	0.270	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:6gd1A	0.297	0.406	1.975E-8	190	0.073	0.100	6gd1A.pdb.gz
17	PDB:5gm6V	0.316	0.629	2.759E-8	128	0.103	0.211	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:5oobB	0.316	0.535	6.584E-8	152	0.084	0.145	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
19	PDB:5xjcw	0.294	0.820	7.526E-8	91	0.084	0.242	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:6zmwo	0.280	0.903	8.604E-8	77	0.080	0.273	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z504	0.0	513	262	1.000	1.000	A0A0S2Z504_HUMAN Serine/arginine-rich splicing factor 10 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF10 PE=2 SV=1
2	A0A8I6A795	0.0	506	261	0.996	1.000	A0A8I6A795_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
3	A0A8J8XB26	0.0	513	262	1.000	1.000	A0A8J8XB26_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
4	O75494	0.0	513	262	1.000	1.000	SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10 PE=1 SV=1
5	Q9R0U0	0.0	513	262	1.000	1.000	SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus OX=10090 GN=Srsf10 PE=1 SV=2
6	Q4KM38	3.65e-117	334	164	0.626	1.000	Q4KM38_RAT FUS interacting protein (Serine-arginine rich) 1 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
7	A0A8I6AMK7	5.35e-117	334	183	0.626	0.896	A0A8I6AMK7_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
8	Q8WXF0	2.99e-67	211	261	0.473	0.475	SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1
9	Q9LHP2	9.09e-27	106	262	0.317	0.317	SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana OX=3702 GN=SCL30A PE=1 SV=1
10	Q9SEU4	8.55e-26	104	287	0.164	0.150	SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana OX=3702 GN=SCL33 PE=1 SV=1
11	Q1PDV2	3.61e-23	96.3	236	0.168	0.186	SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana OX=3702 GN=SCL28 PE=1 SV=1
12	Q8I468	2.98e-21	92.8	308	0.164	0.140	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
13	Q8L3X8	3.99e-21	91.7	262	0.153	0.153	SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana OX=3702 GN=SCL30 PE=1 SV=1
14	Q9V3T8	3.76e-17	79.3	195	0.160	0.215	Q9V3T8_DROME LD32469p OS=Drosophila melanogaster OX=7227 GN=SC35 PE=1 SV=1
15	J3QL05	1.27e-15	73.6	130	0.156	0.315	J3QL05_HUMAN Serine and arginine rich splicing factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=1
16	J3KP15	1.37e-15	73.6	133	0.156	0.308	J3KP15_HUMAN Serine and arginine rich splicing factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=8
17	P62995	5.81e-15	75.1	288	0.191	0.174	TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
18	P62996	5.81e-15	75.1	288	0.191	0.174	TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus OX=10090 GN=Tra2b PE=1 SV=1
19	P62997	5.81e-15	75.1	288	0.191	0.174	TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus OX=10116 GN=Tra2b PE=1 SV=1
20	Q01130	7.55e-15	73.6	221	0.156	0.186	SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	1.5	20.2	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	1.5e-16	71.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008571334.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008587127.1	0.981	Serine/arginine-rich splicing factor 1
2	482537.XP_008564753.1	0.924	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
3	482537.XP_008576098.1	0.911	Transformer-2 protein homolog beta isoform X1
4	482537.XP_008566892.1	0.885	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 19 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008567581.1	0.862	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 14 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008590065.1	0.861	Serine/arginine-rich splicing factor 3
7	482537.XP_008561413.1	0.852	Heterogeneous nuclear ribonucleoprotein F
8	482537.XP_008573512.1	0.851	Serine/arginine-rich splicing factor 7 isoform X1
9	482537.XP_008582892.1	0.804	Heterogeneous nuclear ribonucleoprotein H2
10	482537.XP_008579541.1	0.769	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008567267.1	0.766	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
12	482537.XP_008580739.1	0.751	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008586320.1	0.749	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 17 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008592541.1	0.746	RNA-binding protein FUS isoform X1
15	482537.XP_008592281.1	0.743	Small nuclear ribonucleoprotein Sm D3
16	482537.XP_008583621.1	0.741	Serine/arginine-rich splicing factor 5 isoform X1
17	482537.XP_008590112.1	0.740	Serine/arginine-rich splicing factor 6
18	482537.XP_008567542.1	0.735	U1 small nuclear ribonucleoprotein 70 kDa isoform X1
19	482537.XP_008579328.1	0.723	poly(rC)-binding protein 3 isoform X1
20	482537.XP_008582146.1	0.723	Heterogeneous nuclear ribonucleoprotein M isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.915	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000398	0.999	mRNA splicing, via spliceosome
GO:0048024	0.996	regulation of mRNA splicing, via spliceosome
GO:0071840	0.995	cellular component organization or biogenesis
GO:0000245	0.985	spliceosomal complex assembly
GO:0006376	0.982	mRNA splice site selection
GO:0048519	0.980	negative regulation of biological process
GO:0010605	0.968	negative regulation of macromolecule metabolic process
GO:0031324	0.962	negative regulation of cellular metabolic process
GO:0051172	0.961	negative regulation of nitrogen compound metabolic process
GO:0010629	0.956	negative regulation of gene expression
GO:0033119	0.932	negative regulation of RNA splicing
GO:1903312	0.916	negative regulation of mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016604	0.907	nuclear body
GO:0016607	0.827	nuclear speck
GO:0032991	0.443	protein-containing complex
GO:0005737	0.346	cytoplasm
GO:0030054	0.308	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]