StarFunc result for job id O75496

User Input

>input (209 residues)
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL
HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET
VEDSLVEDSEIGTCAEGTVSSSTDAKPCI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZY7	0.429	0.429	2.303E-24	209	1.000	1.000	A0A024QZY7.pdb.gz
2	AFDB:O88513	0.399	0.405	7.038E-18	206	0.775	0.786	O88513.pdb.gz	GEMI_MOUSE Geminin OS=Mus musculus OX=10090 GN=Gmnn PE=1 SV=1
3	AFDB:O93352	0.388	0.373	4.759E-10	219	0.522	0.498	O93352.pdb.gz	O93352_XENLA GMNN protein OS=Xenopus laevis OX=8355 GN=gmnn.S PE=1 SV=1
4	AFDB:B0LHV2	0.398	0.373	1.387E-8	224	0.502	0.469	B0LHV2.pdb.gz	B0LHV2_CHICK Truncated geminin OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:Q1LU98	0.377	0.330	1.714E-6	241	0.455	0.394	Q1LU98.pdb.gz
6	AFDB:Q709D5	0.368	0.333	2.509E-5	233	0.359	0.322	Q709D5.pdb.gz	Q709D5_ORYLA Geminin OS=Oryzias latipes OX=8090 PE=2 SV=1
7	AFDB:Q9FRH4	0.277	0.167	1.926E-1	362	0.187	0.108	Q9FRH4.pdb.gz	IDD16_ARATH Protein indeterminate-domain 16 OS=Arabidopsis thaliana OX=3702 GN=IDD16 PE=2 SV=1
8	AFDB:Q08182	0.219	0.194	2.368E-1	245	0.172	0.147	Q08182.pdb.gz	YAP7_YEAST AP-1-like transcription factor YAP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP7 PE=1 SV=1
9	AFDB:Q383B5	0.170	0.053	6.205E-1	1006	0.158	0.033	Q383B5.pdb.gz	Q383B5_TRYB2 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3520 PE=4 SV=1
10	AFDB:Q4WIA4	0.219	0.164	6.205E-1	302	0.158	0.109	Q4WIA4.pdb.gz	Q4WIA4_ASPFU BZIP transcription factor (Fcr3), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G02540 PE=4 SV=1
11	PDB:5lj5O	0.097	0.081	8.773	283	0.081	0.060	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7w59R	0.161	0.126	8.773	280	0.100	0.075	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:5wlcST	0.134	0.058	9.398	599	0.081	0.028	5wlcST.pdb.gz	The complete structure of the small-subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75496	5.41e-153	424	209	1.000	1.000	GEMI_HUMAN Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1
2	E2QRF9	4.93e-129	362	179	0.856	1.000	E2QRF9_HUMAN Geminin DNA replication inhibitor (Fragment) OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1
3	O88513	8.95e-111	317	206	0.775	0.786	GEMI_MOUSE Geminin OS=Mus musculus OX=10090 GN=Gmnn PE=1 SV=1
4	H7C608	5.94e-70	210	102	0.488	1.000	H7C608_HUMAN Geminin DNA replication inhibitor (Fragment) OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1
5	O93352	1.90e-55	177	219	0.502	0.479	O93352_XENLA GMNN protein OS=Xenopus laevis OX=8355 GN=gmnn.S PE=1 SV=1
6	Q5ZKE6	2.84e-54	173	187	0.464	0.519	Q5ZKE6_CHICK Geminin OS=Gallus gallus OX=9031 GN=RCJMB04_11f7 PE=2 SV=1
7	B0LHV2	3.98e-53	171	224	0.455	0.424	B0LHV2_CHICK Truncated geminin OS=Gallus gallus OX=9031 PE=2 SV=1
8	Q7SXL0	7.11e-41	140	241	0.378	0.328	Q7SXL0_DANRE Geminin OS=Danio rerio OX=7955 GN=sb:cb254 PE=2 SV=1
9	Q709D5	7.47e-37	130	233	0.354	0.318	Q709D5_ORYLA Geminin OS=Oryzias latipes OX=8090 PE=2 SV=1
10	Q3UZ45	1.20e-11	65.1	379	0.134	0.074	MCIN_MOUSE Multicilin OS=Mus musculus OX=10090 GN=Mcidas PE=1 SV=1
11	D6RGH6	2.77e-11	63.9	385	0.134	0.073	MCIN_HUMAN Multicilin OS=Homo sapiens OX=9606 GN=MCIDAS PE=1 SV=1
12	Q08B36	1.81e-07	52.8	374	0.120	0.067	MCIN_XENLA Multicilin OS=Xenopus laevis OX=8355 GN=mcidas PE=1 SV=2
13	Q7JX41	4.98e-04	41.6	192	0.129	0.141	Q7JX41_DROME Geminin OS=Drosophila melanogaster OX=7227 GN=geminin PE=1 SV=1
14	A0A178WAA1	0.005	39.3	339	0.177	0.109	A0A178WAA1_ARATH RING-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g10650 PE=1 SV=1
15	Q84JF9	0.005	39.3	339	0.177	0.109	Q84JF9_ARATH Putative S-ribonuclease binding protein SBP1 OS=Arabidopsis thaliana OX=3702 GN=At1g10650 PE=2 SV=1
16	H2L0Q3	0.32	34.3	899	0.120	0.028	GABR1_CAEEL Gamma-aminobutyric acid type B receptor subunit 1 OS=Caenorhabditis elegans OX=6239 GN=gbb-1 PE=1 SV=2
17	A0A0H3MBG2	0.43	33.5	405	0.100	0.052	A0A0H3MBG2_CHLT2 Integral membrane protein OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=CTL0223 PE=1 SV=1
18	Q8CJ52	0.76	33.1	834	0.187	0.047	PROM2_RAT Prominin-2 OS=Rattus norvegicus OX=10116 GN=Prom2 PE=1 SV=1
19	Q62839	1.6	32.0	998	0.120	0.025	GOGA2_RAT Golgin subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=4
20	I3LSP4	1.7	32.0	1005	0.124	0.026	I3LSP4_PIG Golgin subfamily A member 2 OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	1.4e+02	12.4	Aldehyde dehydrogenase family
2	PF18504 Csm1_N	51	15.6	Csm1 N-terminal domain
3	PF04977 DivIC	1.8e+02	13.3	Septum formation initiator
4	PF18709 DLP_helical	12	16.6	Dynamin-like helical domain
5	PF10359 Fmp27_WPPW	3	18.3	RNA pol II promoter Fmp27 protein domain
6	PF07412 Geminin	1.2e-78	274.8	Geminin
7	PF15784 GPS2_interact	1.2e+02	14.5	G-protein pathway suppressor 2-interacting domain
8	PF15003 HAUS2	92	14.2	HAUS augmin-like complex subunit 2
9	PF09472 MtrF	4.8e+02	11.6	Tetrahydromethanopterin S-methyltransferase, F subunit (MtrF)
10	PF01895 PhoU	9.6e+02	11.7	PhoU domain
11	PF12252 SidE_PDE	1.5e+02	13.2	SidE phosphodiesterase (PDE) domain
12	PF06785 UPF0242	9.7e+02	11.2	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301019	0.999	DNA replication factor Cdt1
2	9606.ENSP00000264156	0.992	DNA replication licensing factor MCM6
3	9606.ENSP00000209728	0.988	Cell division control protein 6 homolog
4	9606.ENSP00000260653	0.987	Homeobox protein SIX3
5	9606.ENSP00000378699	0.985	Cyclin-dependent kinase 1
6	9606.ENSP00000265056	0.976	DNA replication licensing factor MCM2
7	9606.ENSP00000274026	0.957	Cyclin-A2
8	9606.ENSP00000480987	0.949	DNA replication licensing factor MCM3
9	9606.ENSP00000307288	0.948	DNA replication licensing factor MCM7
10	9606.ENSP00000395654	0.944	Transcription activator BRG1
11	9606.ENSP00000368458	0.943	Proliferating cell nuclear antigen
12	9606.ENSP00000405726	0.936	Cell division control protein 45 homolog
13	9606.ENSP00000361540	0.933	Cell division cycle protein 20 homolog
14	9606.ENSP00000386541	0.932	26S proteasome non-ATPase regulatory subunit 14
15	9606.ENSP00000204517	0.929	Transcription factor AP-4
16	9606.ENSP00000262105	0.929	DNA replication licensing factor MCM4
17	9606.ENSP00000229758	0.928	F-box only protein 5
18	9606.ENSP00000483688	0.928	Proteasome subunit beta type-3
19	9606.ENSP00000256442	0.925	G2/mitotic-specific cyclin-B1
20	9606.ENSP00000219097	0.923	Origin recognition complex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008134	0.897	transcription factor binding
GO:0003712	0.879	transcription coregulator activity
GO:0140297	0.830	DNA-binding transcription factor binding
GO:0003714	0.347	transcription corepressor activity
GO:0003682	0.310	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0080090	0.993	regulation of primary metabolic process
GO:0009987	0.992	cellular process
GO:0048519	0.992	negative regulation of biological process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0009892	0.972	negative regulation of metabolic process
GO:0051726	0.961	regulation of cell cycle
GO:0048523	0.960	negative regulation of cellular process
GO:0010605	0.957	negative regulation of macromolecule metabolic process
GO:0045786	0.940	negative regulation of cell cycle
GO:0051052	0.928	regulation of DNA metabolic process
GO:0065009	0.925	regulation of molecular function
GO:0010468	0.903	regulation of gene expression
GO:0071840	0.897	cellular component organization or biogenesis
GO:0016043	0.891	cellular component organization
GO:0071704	0.881	organic substance metabolic process
GO:0006275	0.868	regulation of DNA replication
GO:0044238	0.858	primary metabolic process
GO:0045934	0.846	negative regulation of nucleobase-containing compound metabolic process
GO:0006807	0.844	nitrogen compound metabolic process
GO:0051053	0.835	negative regulation of DNA metabolic process
GO:0044237	0.792	cellular metabolic process
GO:0043170	0.761	macromolecule metabolic process
GO:0008156	0.718	negative regulation of DNA replication
GO:0022607	0.716	cellular component assembly
GO:0051098	0.681	regulation of binding
GO:0043933	0.599	protein-containing complex organization
GO:0044260	0.564	cellular macromolecule metabolic process
GO:0007049	0.511	cell cycle
GO:0031326	0.508	regulation of cellular biosynthetic process
GO:0010556	0.502	regulation of macromolecule biosynthetic process
GO:0022402	0.494	cell cycle process
GO:0006139	0.465	nucleobase-containing compound metabolic process
GO:0090304	0.458	nucleic acid metabolic process
GO:0065003	0.367	protein-containing complex assembly
GO:2001141	0.345	regulation of RNA biosynthetic process
GO:0006355	0.336	regulation of DNA-templated transcription
GO:0045892	0.319	negative regulation of DNA-templated transcription
GO:0006259	0.311	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.943	protein-containing complex
GO:0043232	0.797	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]